Human aldolase A wild type. Determined by X-ray diffraction at 1.95 Å resolution. Released 7 Jul 2021.
Explore 6XMH in 3D Show helices and sheets RCSB PDB PDBe
6XMH contains 35 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-23 | 14 | |
| β-strand | 29-33 | 5 | 1 |
| α-helix | 37-44 | 8 | |
| α-helix | 45-47 | 3 | |
| α-helix | 53-64 | 12 | |
| β-strand | 74-79 | 6 | 1 |
| α-helix | 81-84 | 4 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 93 | 1 | 2 |
| α-helix | 94-100 | 7 | |
| β-strand | 104-108 | 5 | 1 |
| β-strand | 113-115 | 3 | 3 |
| β-strand | 123-125 | 3 | 3 |
| α-helix | 131-140 | 10 | |
| β-strand | 145-152 | 8 | 1 |
| β-strand | 155 | 1 | 4 |
| β-strand | 158 | 1 | 4 |
| α-helix | 161-180 | 20 | |
| β-strand | 184-191 | 8 | 1 |
| α-helix | 192 | 1 | |
| α-helix | 199-219 | 21 | |
| α-helix | 224-226 | 3 | |
| β-strand | 228-229 | 2 | 1 |
| α-helix | 231-233 | 3 | |
| α-helix | 246-258 | 13 | |
| β-strand | 267-270 | 4 | 1 |
| α-helix | 277-288 | 12 | |
| β-strand | 297-302 | 6 | 1 |
| α-helix | 304-314 | 11 | |
| α-helix | 318-320 | 3 | |
| α-helix | 321-338 | 18 | |
| α-helix | 351-354 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-23 | 14 | |
| β-strand | 29-33 | 5 | 5 |
| α-helix | 37-45 | 9 | |
| α-helix | 53-64 | 12 | |
| β-strand | 74-79 | 6 | 5 |
| α-helix | 81-84 | 4 | |
| β-strand | 87 | 1 | 6 |
| β-strand | 93 | 1 | 6 |
| α-helix | 94-100 | 7 | |
| β-strand | 104-108 | 5 | 5 |
| β-strand | 113-115 | 3 | 7 |
| β-strand | 123-125 | 3 | 7 |
| α-helix | 131-140 | 10 | |
| β-strand | 145-152 | 8 | 5 |
| β-strand | 155 | 1 | 8 |
| β-strand | 158 | 1 | 8 |
| α-helix | 161-180 | 20 | |
| β-strand | 184-191 | 8 | 5 |
| α-helix | 192 | 1 | |
| α-helix | 199-219 | 21 | |
| α-helix | 224-226 | 3 | |
| β-strand | 228-229 | 2 | 5 |
| α-helix | 231 | 1 | |
| β-strand | 232 | 1 | 9 |
| α-helix | 233 | 1 | |
| α-helix | 246-258 | 13 | |
| β-strand | 267-270 | 4 | 5 |
| β-strand | 271 | 1 | 9 |
| α-helix | 277-289 | 13 | |
| β-strand | 297-302 | 6 | 5 |
| α-helix | 304-314 | 11 | |
| α-helix | 318-320 | 3 | |
| α-helix | 321-338 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fructose-bisphosphate aldolase A | A, B | protein | 364 | Homo sapiens | P04075 (AlphaFold model) |
>6XMH_1 Fructose-bisphosphate aldolase A (chains A, B) MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS NHAY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 4 |
Water and common crystallization additives (GOL) are not listed.
Substitutions at a rheostat position in human aldolase A cause a shift in the conformational population. Fenton, K.D., Meneely, K.M., Wu, T. et al. Protein Sci (2022) 31:357-370. DOI 10.1002/pro.4222 · PubMed
Other PDB entries of the same protein (UniProt P04075 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6XMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.