6XML: Human aldolase A I98C

Human aldolase A I98C. Determined by X-ray diffraction at 1.88 Å resolution. Released 7 Jul 2021.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,693
Mol. weight: 79.85 kDa
Ligands: PO4
Released: 7 Jul 2021

Explore 6XML in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XML contains 33 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	29-33	5	1
α-helix	40-45	6
α-helix	53-64	12
α-helix	68-73	6
β-strand	74-79	6	1
α-helix	81-84	4
β-strand	87	1	2
β-strand	93	1	2
α-helix	94-100	7
α-helix	103	1
β-strand	104-108	5	1
β-strand	113-115	3	3
β-strand	123-125	3	3
α-helix	131-140	10
β-strand	145-152	8	1
β-strand	155	1	4
β-strand	158	1	4
α-helix	161-180	20
β-strand	184-191	8	1
α-helix	199-219	21
α-helix	224-226	3
β-strand	228-229	2	1
β-strand	232	1	5
α-helix	246-258	13
β-strand	267-270	4	1
β-strand	271	1	5
α-helix	277-289	13
β-strand	297-302	6	1
α-helix	304-314	11
α-helix	318-320	3
α-helix	321-338	18

Chain B: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
β-strand	29-33	5	6
α-helix	37-45	9
α-helix	53-64	12
β-strand	74-79	6	6
α-helix	81-84	4
β-strand	87	1	7
β-strand	93	1	7
α-helix	94-100	7
β-strand	104-108	5	6
β-strand	113-115	3	8
β-strand	123-125	3	8
α-helix	131-140	10
β-strand	143-152	10	6
β-strand	155	1	9
β-strand	158	1	9
α-helix	161-180	20
β-strand	184-191	8	6
α-helix	192	1
α-helix	199-219	21
α-helix	224-226	3
β-strand	228-229	2	6
α-helix	231-233	3
α-helix	246-258	13
β-strand	267-270	4	6
α-helix	277-289	13
β-strand	297-302	6	6
α-helix	304-314	11
α-helix	318-320	3
α-helix	321-338	18
α-helix	351-354	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fructose-bisphosphate aldolase A	A, B	protein	364	Homo sapiens	P04075 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6XML_1 Fructose-bisphosphate aldolase A (chains A, B)
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVCKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
NHAY

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Substitutions at a rheostat position in human aldolase A cause a shift in the conformational population. Fenton, K.D., Meneely, K.M., Wu, T. et al. Protein Sci (2022) 31:357-370. DOI 10.1002/pro.4222 · PubMed

Other PDB entries of the same protein (UniProt P04075 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KY6 1.94 Å, Human muscle fructose-1,6-bisphosphate aldolase
6XMH 1.95 Å, Human aldolase A wild type
1ALD 2.0 Å, Activity and specificity of human aldolases
2ALD 2.1 Å, Human muscle aldolase
6XMM 2.11 Å, Human aldolase A I98S
6XMO 2.6 Å, Human aldolase A I98F
4ALD 2.8 Å, Human muscle fructose 1,6-bisphosphate aldolase complexed with fructose 1,6-bisphosphate

Browse structure collections

About this viewer

MolViewer shows 6XML directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.