Receptor for Advanced Glycation End Products VC1 domain in complex with Fragments 1 & 13. Determined by X-ray diffraction at 2.3 Å resolution. Released 14 Jul 2021.
Explore 6XQ9 in 3D Show helices and sheets RCSB PDB PDBe
6XQ9 contains 14 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-29 | 6 | 1 |
| β-strand | 34-36 | 3 | 2 |
| β-strand | 48-55 | 8 | 1 |
| β-strand | 62-64 | 3 | 1 |
| α-helix | 71-74 | 4 | |
| β-strand | 77-78 | 2 | 2 |
| β-strand | 84-86 | 3 | 2 |
| α-helix | 91-93 | 3 | |
| β-strand | 95-102 | 8 | 1 |
| β-strand | 108-118 | 11 | 1 |
| β-strand | 119 | 1 | 3 |
| α-helix | 120-124 | 5 | |
| β-strand | 125-129 | 5 | 4 |
| β-strand | 132-134 | 3 | 5 |
| β-strand | 139-149 | 11 | 4 |
| β-strand | 150 | 1 | 3 |
| β-strand | 154-159 | 6 | 6 |
| β-strand | 162-163 | 2 | 6 |
| α-helix | 164-165 | 2 | |
| β-strand | 171-179 | 9 | 4 |
| β-strand | 186-194 | 9 | 4 |
| α-helix | 196-197 | 2 | |
| β-strand | 206-211 | 6 | 6 |
| α-helix | 217-219 | 3 | |
| β-strand | 220-221 | 2 | 6 |
| α-helix | 222-224 | 3 | |
| β-strand | 225 | 1 | 6 |
| β-strand | 228-230 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 24-29 | 6 | 7 |
| β-strand | 34-36 | 3 | 8 |
| β-strand | 48-55 | 8 | 7 |
| β-strand | 62-64 | 3 | 7 |
| α-helix | 71-74 | 4 | |
| β-strand | 77-78 | 2 | 8 |
| β-strand | 84-86 | 3 | 8 |
| α-helix | 91-93 | 3 | |
| β-strand | 95-102 | 8 | 7 |
| β-strand | 108-118 | 11 | 7 |
| β-strand | 119 | 1 | 9 |
| α-helix | 120-124 | 5 | |
| β-strand | 125-127 | 3 | 10 |
| β-strand | 132-134 | 3 | 11 |
| β-strand | 139-149 | 11 | 10 |
| β-strand | 150 | 1 | 9 |
| β-strand | 154-159 | 6 | 12 |
| β-strand | 162-163 | 2 | 12 |
| α-helix | 164-165 | 2 | |
| β-strand | 168 | 1 | 10 |
| β-strand | 171-179 | 9 | 10 |
| β-strand | 186-194 | 9 | 10 |
| α-helix | 196-197 | 2 | |
| β-strand | 206-211 | 6 | 12 |
| α-helix | 217-219 | 3 | |
| β-strand | 220-221 | 2 | 12 |
| α-helix | 222-224 | 3 | |
| β-strand | 225 | 1 | 12 |
| β-strand | 228-230 | 3 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Advanced glycosylation end product-specific receptor | A, B | protein | 212 | Homo sapiens | Q15109 (AlphaFold model) |
>6XQ9_1 Advanced glycosylation end product-specific receptor (chains A, B) GAMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVL PNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPN KVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARG GDPRPTFSCSFSPGLPRHRALRTAPIQPRVWE
| ID | Name | Formula | Copies |
|---|---|---|---|
| V6M | 7-methyl-3-phenyl-1H-indole-2-carboxylic acid | C16 H13 N O2 | 2 |
| V6S | 4-(3-hydroxyphenoxy)benzoic acid | C13 H10 O4 | 4 |
Water and common crystallization additives (ACT) are not listed.
A fragment-based approach to discovery of Receptor for Advanced Glycation End products inhibitors. Kozlyuk, N., Gilston, B.A., Salay, L.E. et al. Proteins (2021) 89:1399-1412. DOI 10.1002/prot.26162 · PubMed
Other PDB entries of the same protein (UniProt Q15109 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6XQ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.