6XWS: Drosophila CAL1 1-160

Crystal Structure of Drosophila CAL1 1-160 bound to CENP-A/H4. Determined by X-ray diffraction at 4.36 Å resolution. Released 15 Apr 2020.

Method: X-ray diffraction
Resolution: 4.36 Å
Organism: Drosophila melanogaster
Chains: 3
Atoms: 1,715
Mol. weight: 47.92 kDa
Released: 15 Apr 2020

Explore 6XWS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XWS contains 13 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	51-64	14
α-helix	74-101	28
β-strand	106-107	2	1
α-helix	109-117	9

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	32-41	10
β-strand	46-47	2	1
α-helix	50-76	27
α-helix	84-92	9

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	8-29	22
α-helix	39-42	4
α-helix	65-71	7
α-helix	101-116	16
α-helix	123-128	6
α-helix	134-139	6
α-helix	141-144	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein cid	A	protein	225	Drosophila melanogaster	Q9V6Q2 (AlphaFold model)
Histone H4	B	protein	103	Drosophila melanogaster	P84040 (AlphaFold model)
Chromosome alignment defect 1,Chromosome alignment defect 1	C	protein	108	Drosophila melanogaster	Q9VEN2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6XWS_1 Histone H3-like centromeric protein cid (chains A)
MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTL
RRDAGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRR
RKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAM
QESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQF

Sequence of entity 2 (B), FASTA

>6XWS_2 Histone H4 (chains B)
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Sequence of entity 3 (C), FASTA

>6XWS_3 Chromosome alignment defect 1,Chromosome alignment defect 1 (chains C)
MANAVVDEETLEAMVYERSKAWSSKMADFASLEDGMEIDVAEFDNLFXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Primary citation

Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1. Medina-Pritchard, B., Lazou, V., Zou, J. et al. EMBO J (2020) 39:e103234-e103234. DOI 10.15252/embj.2019103234 · PubMed

Other PDB entries of the same protein (UniProt Q9V6Q2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XWT 3.47 Å, drosophila melanogaster CENP-A/H4 bound to N-terminal CAL1 fragment

Browse structure collections

About this viewer

MolViewer shows 6XWS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.