6Y17: NCoR1BBD2-BCL6BTB chimera

Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with nebulinSH3-NCoR1BBD1. Determined by X-ray diffraction at 1.56 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,654
Mol. weight: 48.96 kDa
Released: 2 Dec 2020

Explore 6Y17 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Y17 contains 21 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	1
α-helix	14-27	14
β-strand	34-38	5	2
β-strand	41-45	5	2
α-helix	47-53	7
α-helix	55-61	7
β-strand	71-73	3	2
α-helix	74-75	2
α-helix	80-92	13
β-strand	94-97	4	3
α-helix	102-111	10
α-helix	115-125	11
β-strand	126	1	4

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	-2	1	4
β-strand	7-11	5	3
α-helix	14-27	14
β-strand	34-38	5	5
β-strand	41-45	5	5
α-helix	47-53	7
α-helix	55-61	7
α-helix	64-66	3
β-strand	71-73	3	5
α-helix	74-75	2
α-helix	80-92	13
β-strand	94-97	4	1
α-helix	102-111	10
α-helix	115-125	11

Chain C: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	6
β-strand	12	1	7
β-strand	19	1	6
β-strand	22	1	7
β-strand	27-33	7	6
β-strand	38-43	6	6
β-strand	49-53	5	6
α-helix	54-56	3
β-strand	57-59	3	6
α-helix	60-61	2
α-helix	64-65	2
β-strand	66-70	5	1
α-helix	76-79	4

Chain D: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	8
β-strand	12	1	9
β-strand	19	1	8
β-strand	22	1	9
β-strand	27-35	9	8
β-strand	38-43	6	8
β-strand	49-53	5	8
α-helix	54-56	3
β-strand	57-61	5	8
β-strand	66-70	5	3
α-helix	76-79	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor corepressor 1,B-cell lymphoma 6 protein	A, B	protein	137	Homo sapiens	O75376 (AlphaFold model), P41182 (AlphaFold model)
Nebulin,Nuclear receptor corepressor 1	C, D	protein	82	Homo sapiens	O75376 (AlphaFold model), P20929

Sequence of entity 1 (A, B), FASTA

>6Y17_1 Nuclear receptor corepressor 1,B-cell lymphoma 6 protein (chains A, B)
GPSSDLYLRPGGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMA
CSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYL
QMEHVVDTCRKFIKASE

Sequence of entity 2 (C, D), FASTA

>6Y17_2 Nebulin,Nuclear receptor corepressor 1 (chains C, D)
GPTAGKIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVE
AIGGGGITTIKEMGRSIHEIPR

Primary citation

Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone. Zacharchenko, T., Wright, S. IUCrJ (2021) 8:154-160. DOI 10.1107/S2052252520015754 · PubMed

Other PDB entries of the same protein (UniProt O75376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XZZ 1.39 Å, Crystal structure of the BCL6 BTB domain in complex with the NCoR1 BBD2 peptide
8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
6XYX 1.44 Å, Crystal structure of the BCL6 BTB domain in complex with the NCoR1 BBD corepressor peptide
8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
6ONI 1.8 Å, Crystal structure of PPARgamma ligand binding domain in complex with N-CoR peptide and…
8FHE 1.8 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
8FHG 1.8 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
8FKF 1.82 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
8DKN 1.95 Å, PPARg bound to T0070907 and Co-R peptide
6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
8FKE 2.02 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
3KMZ 2.1 Å, Crystal structure of RARalpha ligand binding domain in complex with the inverse agonist…

Browse structure collections

About this viewer

MolViewer shows 6Y17 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.