6Y59: 5-HT3A receptor in Salipro

5-HT3A receptor in Salipro (apo, C5 symmetric). Determined by electron microscopy at 3.2 Å resolution. Released 23 Dec 2020.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 5
Atoms: 15,865
Mol. weight: 303.34 kDa
Released: 23 Dec 2020

Explore 6Y59 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Y59 contains 60 α-helices and 100 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 12 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	11-20	10
β-strand	39-42	4	1
β-strand	45-52	8	2
β-strand	57-62	6	2
β-strand	64	1	3
β-strand	65-74	10	1
α-helix	77-79	3
β-strand	85-89	5	1
α-helix	90-92	3
β-strand	98-100	3	4
β-strand	105	1	2
β-strand	114-118	5	1
β-strand	120-124	5	1
β-strand	127	1	3
β-strand	130-134	5	2
β-strand	146-147	2	5
β-strand	153-155	3	4
β-strand	165	1	1
α-helix	171-176	6
β-strand	187	1	6
β-strand	192-199	8	4
β-strand	207-214	8	4
β-strand	216-217	2	5
β-strand	218	1	6
α-helix	221-223	3
α-helix	224-228	5
α-helix	229-241	13
α-helix	249-272	24
α-helix	282-308	27
α-helix	318-332	15
α-helix	403-414	12
α-helix	420-461	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 3A	A, B, C, D, E	protein	538	Mus musculus	P23979 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6Y59_1 5-hydroxytryptamine receptor 3A (chains A, B, C, D, E)
MWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGGSGGGSGGG
SWSHPQFEKENLYFQGATQARDTTQPALLRLSDHLLANYKKGVRPVRDWRKPTTVSIDVI
MYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIWVPDILINEFV
DVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDIN
ITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYVIIRRRPLFYA
VSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIG
VYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCLGEQPMAHRP
PATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREASLAVRGLLQ
ELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIWHSS

Primary citation

Asymmetric opening of the homopentameric 5-HT 3A serotonin receptor in lipid bilayers. Zhang, Y., Dijkman, P.M., Zou, R. et al. Nat Commun (2021) 12:1074-1074. DOI 10.1038/s41467-021-21016-7 · PubMed

Other PDB entries of the same protein (UniProt P23979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FRX 2.7 Å, Full-length mouse 5-HT3A receptor in complex with SMP100, pre-activated
8FRZ 2.75 Å, Full-length mouse 5-HT3A receptor in complex with serotonin, pre-activated
8FSB 2.75 Å, Full-length mouse 5-HT3A receptor in complex with serotonin, open-like
6Y5A 2.8 Å, Serotonin-bound 5-HT3A receptor in Salipro
6Y1Z 2.82 Å, Mouse serotonin 5HT3 receptor in complex with palonosetron
6NP0 2.92 Å, Cryo-EM structure of 5HT3A receptor in presence of granisetron
6W1J 2.92 Å, Cryo-EM structure of 5HT3A receptor in presence of Alosetron
8FRW 2.92 Å, Full-length mouse 5-HT3A receptor in complex with ALB148471, pre-activated
8CC7 3.0 Å, Mouse serotonin 5-HT3A receptor in complex with PZ-1939
8AW2 3.01 Å, Mouse serotonin 5-HT3A receptor in complex with vortioxetine
6W1M 3.06 Å, Cryo-EM structure of 5HT3A receptor in presence of Ondansetron
6Y5B 3.1 Å, 5-HT3A receptor in Salipro (apo, asymmetric)

Browse structure collections

About this viewer

MolViewer shows 6Y59 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.