Crystal structure of MKK7 (MAP2K7) covalently bound with type-II inhibitor SB1-G-23. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Aug 2020.
Explore 6YG7 in 3D Show helices and sheets RCSB PDB PDBe
6YG7 contains 38 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 121-124 | 4 | 1 |
| β-strand | 127-130 | 4 | 1 |
| α-helix | 133-135 | 3 | |
| β-strand | 136-141 | 6 | 2 |
| β-strand | 149-155 | 7 | 2 |
| β-strand | 161-168 | 8 | 2 |
| α-helix | 174-176 | 3 | |
| α-helix | 177-187 | 11 | |
| β-strand | 195 | 1 | 3 |
| α-helix | 196-197 | 2 | |
| β-strand | 198-203 | 6 | 2 |
| β-strand | 207-213 | 7 | 2 |
| β-strand | 217-218 | 2 | 3 |
| α-helix | 219-226 | 8 | |
| α-helix | 229-231 | 3 | |
| α-helix | 232-253 | 22 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265-267 | 3 | 3 |
| β-strand | 273-275 | 3 | 3 |
| α-helix | 302-305 | 4 | |
| α-helix | 318-333 | 16 | |
| α-helix | 344-353 | 10 | |
| α-helix | 355-356 | 2 | |
| α-helix | 358-360 | 3 | |
| α-helix | 367-376 | 10 | |
| α-helix | 381-383 | 3 | |
| α-helix | 385-386 | 2 | |
| α-helix | 387-391 | 5 | |
| α-helix | 394-401 | 8 | |
| α-helix | 406-415 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 120-124 | 5 | 4 |
| β-strand | 127-131 | 5 | 4 |
| α-helix | 133-135 | 3 | |
| β-strand | 136-141 | 6 | 5 |
| β-strand | 149-155 | 7 | 5 |
| β-strand | 161-168 | 8 | 5 |
| α-helix | 174-176 | 3 | |
| α-helix | 177-187 | 11 | |
| β-strand | 195 | 1 | 6 |
| α-helix | 196-197 | 2 | |
| β-strand | 198-203 | 6 | 5 |
| β-strand | 207-213 | 7 | 5 |
| β-strand | 217-218 | 2 | 6 |
| α-helix | 219-226 | 8 | |
| α-helix | 229-231 | 3 | |
| α-helix | 232-253 | 22 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265-267 | 3 | 6 |
| β-strand | 273-275 | 3 | 6 |
| β-strand | 296 | 1 | 7 |
| α-helix | 302-305 | 4 | |
| α-helix | 318-333 | 16 | |
| β-strand | 338 | 1 | 7 |
| α-helix | 344-353 | 10 | |
| α-helix | 355-356 | 2 | |
| α-helix | 358-360 | 3 | |
| α-helix | 367-376 | 10 | |
| α-helix | 381-383 | 3 | |
| α-helix | 385-386 | 2 | |
| α-helix | 387-391 | 5 | |
| α-helix | 394-401 | 8 | |
| α-helix | 406-415 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dual specificity mitogen-activated protein kinase kinase 7 | A, B | protein | 307 | Homo sapiens | O14733 (AlphaFold model) |
>6YG7_1 Dual specificity mitogen-activated protein kinase kinase 7 (chains A, B) SMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKE ENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERI LGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDDKAKDRSA GCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQE EPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVM AKTESPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| OQ2 | ~{N}-[4-[(4-ethylpiperazin-1-yl)methyl]-3-(trifluoromethyl)phenyl]-4-methyl-3-[… | C33 H40 F3 N7 O3 | 2 |
Water and common crystallization additives (EDO) are not listed.
Catalytic Domain Plasticity of MKK7 Reveals Structural Mechanisms of Allosteric Activation and Diverse Targeting Opportunities. Schroder, M., Tan, L., Wang, J. et al. Cell Chem Biol (2020) 27:1285-1295.e4. DOI 10.1016/j.chembiol.2020.07.014 · PubMed
Other PDB entries of the same protein (UniProt O14733 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.