Crystal structure of the CREBBP bromodomain in complex with a benzo-diazepine ligand. Determined by X-ray diffraction at 1.23 Å resolution. Released 15 Apr 2020.
Explore 6YIM in 3D Show helices and sheets RCSB PDB PDBe
6YIM contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1087-1102 | 16 | |
| α-helix | 1109-1111 | 3 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1135-1143 | 9 | |
| α-helix | 1150-1167 | 18 | |
| α-helix | 1173-1196 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Crebbp | A | protein | 119 | Homo sapiens | Q92793 (AlphaFold model) |
>6YIM_1 CREBBP (chains A) SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| OS8 | (4~{R})-~{N}-[3-(7-methoxy-3,4-dihydro-2~{H}-quinolin-1-yl)propyl]-4-methyl-2-o… | C24 H30 N4 O3 | 1 |
Crystal structure of the CREBBP bromodomain in complex with a benzo-diazepine ligand. Picaud, S., Brand, M., Tobias, K. et al. To be published.
Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.