7WX2: CBP-BrD

CBP-BrD complexed with NEO2734. Determined by X-ray diffraction at 1.24 Å resolution. Released 8 Jun 2022.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,220
Mol. weight: 14.85 kDa
Ligands: 7OW
Released: 8 Jun 2022

Explore 7WX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7WX2 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1087-1102	16
α-helix	1109-1111	3
α-helix	1117-1120	4
α-helix	1125-1128	4
α-helix	1135-1143	9
α-helix	1150-1167	18
α-helix	1173-1196	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A	protein	121	Homo sapiens	Q92793 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7WX2_1 CREB-binding protein (chains A)
GSHMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLS
TIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
G

Ligands and cofactors

ID	Name	Formula	Copies
7OW	1,3-dimethyl-5-[2-(oxan-4-yl)-3-[2-(trifluoromethyloxy)ethyl]benzimidazol-5-yl]…	C22 H24 F3 N3 O3	1

Primary citation

Targeting CDCP1 gene transcription coactivated by BRD4 and CBP/p300 in castration-resistant prostate cancer. Ji, D., Shang, G., Wei, E. et al. Oncogene (2022) 41:3251-3262. DOI 10.1038/s41388-022-02327-5 · PubMed

Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I86 1.05 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5J0D 1.05 Å, Crystal structure of the bromodomain of human CREBBP in complex with a benzoxazepine…
5I89 1.07 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5KTW 1.09 Å, CREBBP bromodomain in complex with Cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tet…
4NYX 1.1 Å, Crystal Structure of the Bromodomain of human CREBBP in complex with a…
5EP7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with UN32
4NR7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with an…
6YIL 1.22 Å, Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand
5MMG 1.23 Å, Crystal structure of CREBBP bromodomain complexed with UT07C
5MPN 1.23 Å, Crystal structure of CREBBP bromodomain complexed with FA26
6YIM 1.23 Å, Crystal structure of the CREBBP bromodomain in complex with a benzo-diazepine ligand
5OWK 1.25 Å, Crystal structure of CREBBP bromodomain complexed with DSPB2A002

Browse structure collections

About this viewer

MolViewer shows 7WX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.