6YQJ: CAMP-dependent Protein Kinase

Crystal structure of cAMP-dependent Protein Kinase (PKA) in complex with open-chain Fasudil-derivative 2-[isoquinolin-5-ylsulfonyl(propyl)amino]ethylazanium (soaked). Determined by X-ray diffraction at 1.58 Å resolution. Released 14 Oct 2020.

Method: X-ray diffraction
Resolution: 1.58 Å
Organisms: Cricetulus griseus, Mus musculus
Chains: 2
Atoms: 3,282
Mol. weight: 43.48 kDa
Ligands: 6TX
Released: 14 Oct 2020

Explore 6YQJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YQJ contains 17 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-31	30
α-helix	40-42	3
β-strand	43-52	10	1
β-strand	55-62	8	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-97	13
β-strand	103	1	2
α-helix	104-105	2
β-strand	106-111	6	1
β-strand	115-121	7	1
β-strand	127	1	2
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	3
α-helix	169-171	3
β-strand	172-174	3	2
β-strand	180-182	3	2
β-strand	189-190	2	3
β-strand	195	1	4
β-strand	200	1	5
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	4
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-307	6
α-helix	311-312	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	22	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase catalytic subunit alpha	A	protein	353	Cricetulus griseus	P25321 (AlphaFold model)
cAMP-dependent protein kinase inhibitor alpha	B	protein	19	Mus musculus	P63248 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6YQJ_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A)
GHMGNAAAAKKGSEQESVKEFLAKAKEEFLKKWESPSQNTAQLDHFDRIKTLGTGSFGRV
MLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLY
MVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQ
GYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPP
FFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWF
ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF

Sequence of entity 2 (B), FASTA

>6YQJ_2 cAMP-dependent protein kinase inhibitor alpha (chains B)
IAAGRTGRRQAIHDILVAA

Ligands and cofactors

ID	Name	Formula	Copies
6TX	2-[isoquinolin-5-ylsulfonyl(propyl)amino]ethylazanium	C14 H20 N3 O2 S	1

Primary citation

Two Methods, One Goal: Structural Differences between Cocrystallization and Crystal Soaking to Discover Ligand Binding Poses. Wienen-Schmidt, B., Oebbeke, M., Ngo, K. et al. ChemMedChem (2021) 16:292-300. DOI 10.1002/cmdc.202000565 · PubMed

Other PDB entries of the same protein (UniProt P25321 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5N1F 1.12 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3J 1.12 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
4WIH 1.14 Å, Crystal structure of cAMP-dependent Protein Kinase A from Cricetulus griseus
5N1G 1.14 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3I 1.14 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3S 1.14 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3G 1.16 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N1H 1.18 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
9REC 1.2 Å, Crystal Structure of the Protein-Kinase A catalytic subunit from Cricetulus griseus in…
5N3T 1.21 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3N 1.22 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…
5N3M 1.23 Å, cAMP-dependent Protein Kinase A from Cricetulus griseus in complex with fragment like…

Browse structure collections

About this viewer

MolViewer shows 6YQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.