6YUN: Nucleoprotein

1.45 Angstrom Resolution Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from SARS-CoV-2. Determined by X-ray diffraction at 1.44 Å resolution. Released 20 May 2020.

Method: X-ray diffraction
Resolution: 1.44 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 2,381
Mol. weight: 30.25 kDa
Released: 20 May 2020

Explore 6YUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YUN contains 23 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	13-15	3
β-strand	19	1	1
β-strand	22	1	1
α-helix	24-28	5
β-strand	40	1	2
α-helix	43-48	6
α-helix	49-51	3
α-helix	55-59	5
α-helix	63-64	2
α-helix	65-71	7
β-strand	73-79	7	3
β-strand	82-92	11	3
α-helix	100-110	11
β-strand	111	1	2
α-helix	113-116	4

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	-15--13	3
β-strand	-12	1	4
β-strand	-7	1	4
α-helix	-1-0	2
α-helix	3-4	2
α-helix	5-8	4
α-helix	13-15	3
β-strand	19	1	5
β-strand	22	1	5
α-helix	24-28	5
β-strand	31	1	6
β-strand	38	1	6
β-strand	40	1	7
α-helix	43-48	6
α-helix	49-51	3
α-helix	55-59	5
α-helix	63-64	2
α-helix	65-71	7
β-strand	73-79	7	3
β-strand	82-92	11	3
α-helix	100-110	11
β-strand	111	1	7
α-helix	113-116	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A, B	protein	135	Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6YUN_1 Nucleoprotein (chains A, B)
GSSHHHHHHSQDPNSSSTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQ
ELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQ
VILLNKHIDAYKTFP

Primary citation

High-resolution structure and biophysical characterization of the nucleocapsid phosphoprotein dimerization domain from the Covid-19 severe acute respiratory syndrome coronavirus 2. Zinzula, L., Basquin, J., Bohn, S. et al. Biochem Biophys Res Commun (2021) 538:54-62. DOI 10.1016/j.bbrc.2020.09.131 · PubMed

Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LUZ 1.1 Å, GQTVTK segment from the Nucleoprotein of SARS-CoV-2, residues 243-248
7LTU 1.12 Å, Aalall segment from the nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 1
7VBF 1.3 Å, 1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization…
9F2H 1.3 Å, Crystal structure of SARS-CoV-2 N-protein C-terminal domain in complex with riluzole
7LV2 1.3 Å, GSQASS segment from the Nucleoprotein of SARS-CoV-2, residues 179-184
7LUX 1.3 Å, AALALL segment from the Nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 2
7KGQ 1.34 Å, Crystal Structure of HLA-A*0201in complex with SARS-CoV-2 N222-230
6ZCO 1.36 Å, Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from…
7KGP 1.4 Å, Crystal Structure of HLA-A*0201 in complex with SARS-CoV-2 N316-324
9IN1 1.4 Å, Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2
6WZO 1.42 Å, Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form
7N0R 1.42 Å, Structure of the SARS-CoV-2 N protein RNA-binding domain bound to single-domain antibody…

Browse structure collections

About this viewer

MolViewer shows 6YUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.