6YXP: SWI/SNF complex subunit SMARCC1

Higher resolution structure of the N-terminal module of the human SWI/SNF-subunit BAF155/SMARCC1. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Apr 2021.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,024
Mol. weight: 65.71 kDa
Released: 21 Apr 2021

Explore 6YXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YXP contains 38 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-31	4
α-helix	40-44	5
α-helix	46-51	6
α-helix	53-62	10
α-helix	64-67	4
α-helix	74-92	19
α-helix	102-105	4
α-helix	106-109	4
α-helix	117-131	15
α-helix	146-161	16
β-strand	169-172	4	1
α-helix	178-190	13
β-strand	194-195	2	1
α-helix	199-201	3
β-strand	204-207	4	1
β-strand	218-225	8	2
β-strand	228-233	6	2
α-helix	238-240	3
β-strand	242-245	4	2
α-helix	246-248	3
α-helix	252-259	8
β-strand	263-266	4	1
α-helix	268-276	9
α-helix	279-281	3
α-helix	282-285	4
β-strand	286	1	1
β-strand	287	1	3
β-strand	293	1	3
α-helix	298-299	2
β-strand	300-301	2	2

Chain B: 19 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-31	4
α-helix	40-44	5
α-helix	46-62	17
α-helix	64-67	4
α-helix	74-92	19
α-helix	102-105	4
α-helix	106-109	4
α-helix	117-132	16
α-helix	142-144	3
α-helix	145-161	17
β-strand	169-172	4	4
α-helix	178-190	13
β-strand	194-195	2	4
α-helix	199-201	3
β-strand	204-207	4	4
β-strand	218-225	8	5
β-strand	228-233	6	5
α-helix	238-240	3
β-strand	242-245	4	5
α-helix	251-257	7
α-helix	260	1
β-strand	263-266	4	4
α-helix	268-276	9
α-helix	279-281	3
α-helix	282-285	4
β-strand	286	1	4
β-strand	287	1	6
β-strand	293	1	6
α-helix	298-299	2
β-strand	300-301	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF complex subunit SMARCC1	A, B	protein	280	Homo sapiens	Q92922 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6YXP_1 SWI/SNF complex subunit SMARCC1 (chains A, B)
GSLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHADAPTNKTLAGLVVQLL
QFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQNPSRM
DRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHH
IYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKV
HVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRISTKNE

Primary citation

SWI/SNF subunit BAF155 N-terminus structure informs the impact of cancer-associated mutations and reveals a potential drug binding site. Allen, M.D., Freund, S.M.V., Bycroft, M. et al. Commun Biol (2021) 4:528-528. DOI 10.1038/s42003-021-02050-z · PubMed

Other PDB entries of the same protein (UniProt Q92922 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YXO 2.0 Å, Structure of the N-terminal module of the human SWI/SNF-subunit BAF155/SMARCC1
5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
2YUS Solution structure of the SANT domain of human SWI/SNF-related matrix-associated…
9A0K A structural model of the endogenoushuman SWI/SNF (BAF) complex bound to the nucleosome…

Browse structure collections

About this viewer

MolViewer shows 6YXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.