6Z31: Cation-independent mannose-6-phosphate receptor

Human cation-independent mannose 6-phosphate/ IGF2 receptor domain 8. Determined by X-ray diffraction at 2.56 Å resolution. Released 19 Aug 2020.

Method: X-ray diffraction
Resolution: 2.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,207
Mol. weight: 30.28 kDa
Released: 19 Aug 2020

Explore 6Z31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z31 contains 11 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	1085-1087	3	1
β-strand	1093-1095	3	1
α-helix	1097-1099	3
β-strand	1106-1107	2	2
β-strand	1109	1	3
β-strand	1118-1122	5	2
α-helix	1127-1129	3
β-strand	1139	1	4
β-strand	1141-1145	5	2
β-strand	1148-1151	4	2
β-strand	1154	1	4
α-helix	1158-1159	2
β-strand	1160	1	3
β-strand	1168-1171	4	3
β-strand	1172	1	4
β-strand	1176-1177	2	5
β-strand	1180-1181	2	5
β-strand	1183-1190	8	3
β-strand	1198-1203	6	3
β-strand	1206-1213	8	3
α-helix	1214-1216	3
α-helix	1218	1
β-strand	1219	1	1

Chain B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	1085-1087	3	6
β-strand	1093-1095	3	6
α-helix	1097-1099	3
β-strand	1106-1110	5	7
β-strand	1118-1122	5	7
α-helix	1127-1130	4
β-strand	1139	1	8
β-strand	1141-1145	5	7
β-strand	1148-1151	4	7
β-strand	1154	1	8
α-helix	1158-1159	2
β-strand	1160-1161	2	9
α-helix	1162	1
β-strand	1167-1171	5	9
β-strand	1172	1	8
β-strand	1176-1177	2	10
β-strand	1180-1181	2	10
β-strand	1183-1190	8	9
β-strand	1198-1203	6	9
β-strand	1206-1213	8	9
α-helix	1214-1216	3
α-helix	1218	1
β-strand	1219	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A, B	protein	140	Homo sapiens	P11717 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6Z31_1 Cation-independent mannose-6-phosphate receptor (chains A, B)
SVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCQGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPVV

Primary citation

Structure of the Human Cation-Independent Mannose 6-Phosphate/IGF2 Receptor Domains 7-11 Uncovers the Mannose 6-Phosphate Binding Site of Domain 9. Bochel, A.J., Williams, C., McCoy, A.J. et al. Structure (2020) 28:1300-1312.e5. DOI 10.1016/j.str.2020.08.002 · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1E6F 1.75 Å, Human MIR-receptor, repeat 11
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR

Browse structure collections

About this viewer

MolViewer shows 6Z31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.