Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10. Determined by X-ray diffraction at 1.5 Å resolution. Released 19 Aug 2020.
Explore 6Z30 in 3D Show helices and sheets RCSB PDB PDBe
6Z30 contains 12 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1228-1230 | 3 | 1 |
| β-strand | 1237-1239 | 3 | 1 |
| α-helix | 1241-1244 | 4 | |
| β-strand | 1248-1252 | 5 | 2 |
| β-strand | 1255-1259 | 5 | 2 |
| β-strand | 1279-1285 | 7 | 2 |
| α-helix | 1286 | 1 | |
| β-strand | 1291-1297 | 7 | 2 |
| β-strand | 1303-1305 | 3 | 3 |
| β-strand | 1308-1313 | 6 | 3 |
| β-strand | 1318-1319 | 2 | 4 |
| β-strand | 1323-1324 | 2 | 4 |
| β-strand | 1326-1332 | 7 | 3 |
| β-strand | 1337 | 1 | 5 |
| α-helix | 1338-1340 | 3 | |
| β-strand | 1341-1345 | 5 | 3 |
| β-strand | 1350-1356 | 7 | 3 |
| β-strand | 1357 | 1 | 5 |
| α-helix | 1358-1360 | 3 | |
| α-helix | 1361-1363 | 3 | |
| β-strand | 1366 | 1 | 6 |
| β-strand | 1370-1372 | 3 | 7 |
| β-strand | 1378-1380 | 3 | 7 |
| α-helix | 1382-1384 | 3 | |
| β-strand | 1391-1392 | 2 | 8 |
| α-helix | 1393 | 1 | |
| β-strand | 1394 | 1 | 9 |
| β-strand | 1402-1405 | 4 | 8 |
| β-strand | 1409 | 1 | 6 |
| α-helix | 1410-1413 | 4 | |
| α-helix | 1419-1421 | 3 | |
| β-strand | 1426-1429 | 4 | 8 |
| β-strand | 1435-1436 | 2 | 8 |
| β-strand | 1439 | 1 | 10 |
| β-strand | 1445-1447 | 3 | 9 |
| β-strand | 1450-1455 | 6 | 9 |
| β-strand | 1456 | 1 | 10 |
| β-strand | 1460 | 1 | 11 |
| α-helix | 1461 | 1 | |
| β-strand | 1467 | 1 | 11 |
| β-strand | 1469-1476 | 8 | 9 |
| β-strand | 1486-1491 | 6 | 9 |
| β-strand | 1495-1502 | 8 | 9 |
| α-helix | 1503-1505 | 3 | |
| α-helix | 1507-1508 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cation-independent mannose-6-phosphate receptor | A | protein | 302 | Homo sapiens | P11717 (AlphaFold model) |
>6Z30_1 Cation-independent mannose-6-phosphate receptor (chains A) ETGASVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDKS KVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCHKVYQRSTAIFFYCDRG TQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFDLSSLSRYSDNWEAITG TGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYV DGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAWPTATACPMKSTRHHHH HH
Structure of the Human Cation-Independent Mannose 6-Phosphate/IGF2 Receptor Domains 7-11 Uncovers the Mannose 6-Phosphate Binding Site of Domain 9. Bochel, A.J., Williams, C., McCoy, A.J. et al. Structure (2020) 28:1300-1312.e5. DOI 10.1016/j.str.2020.08.002 · PubMed
Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Z30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.