VEGF-A 13:107 crystallized with 2C bicyclic peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Jun 2021.
Explore 6Z3F in 3D Show helices and sheets RCSB PDB PDBe
6Z3F contains 7 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-13 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 1 |
| α-helix | 17-24 | 8 | |
| β-strand | 25 | 1 | 2 |
| β-strand | 27-34 | 8 | 3 |
| α-helix | 35-38 | 4 | |
| α-helix | 40-42 | 3 | |
| β-strand | 46-48 | 3 | 4 |
| β-strand | 51-58 | 8 | 3 |
| β-strand | 60 | 1 | 2 |
| β-strand | 66-83 | 18 | 4 |
| β-strand | 90-106 | 17 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-15 | 2 | 4 |
| α-helix | 17-24 | 8 | |
| β-strand | 25 | 1 | 5 |
| β-strand | 27-34 | 8 | 6 |
| α-helix | 35-38 | 4 | |
| α-helix | 40-42 | 3 | |
| β-strand | 46-48 | 3 | 1 |
| β-strand | 51-58 | 8 | 6 |
| β-strand | 60 | 1 | 5 |
| β-strand | 66-83 | 18 | 1 |
| β-strand | 89-106 | 18 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chains: P | P | protein | 16 | synthetic construct | |
| Vascular endothelial growth factor A | V, W | protein | 95 | Homo sapiens | P15692 (AlphaFold model) |
>6Z3F_1 Chains: P (chains P) CDIHVLWEWDCFEKLX
>6Z3F_2 Vascular endothelial growth factor A (chains V, W) EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTE ESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NH2 | Amino group | H2 N | 1 |
Water and common crystallization additives (ACY, MPD) are not listed.
Structural and ITC Characterization of Peptide-Protein Binding: Thermodynamic Consequences of Cyclization Constraints, a Case Study on Vascular Endothelial Growth Factor Ligands. Gaucher, J.F., Reille-Seroussi, M., Broussy, S. Chemistry (2022). DOI 10.1002/chem.202200465 · PubMed
Other PDB entries of the same protein (UniProt P15692 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Z3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.