6Z5L: Helical reconstruction of influenza A virus M1

Helical reconstruction of influenza A virus M1 in complex with nucleic acid. Determined by electron microscopy at 3.8 Å resolution. Released 14 Oct 2020.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)
Chains: 1
Atoms: 1,936
Mol. weight: 28.97 kDa
Released: 14 Oct 2020

Explore 6Z5L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z5L contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	16	1
α-helix	19-31	13
α-helix	39-48	10
α-helix	54-67	14
α-helix	78-84	7
α-helix	86-88	3
α-helix	90-104	15
α-helix	109-116	8
α-helix	121-133	13
α-helix	140-166	27
α-helix	171-191	21
α-helix	198-219	22
α-helix	223-225	3
α-helix	229-251	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix protein 1	A	protein	260	Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)	P03485 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6Z5L_1 Matrix protein 1 (chains A)
MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL
GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYS
AGALASCMGLIYNKMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMV
LASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAY
QKRMGVQMQRFKLEHHHHHH

Primary citation

The native structure of the assembled matrix protein 1 of influenza A virus. Peukes, J., Xiong, X., Erlendsson, S. et al. Nature (2020) 587:495-498. DOI 10.1038/s41586-020-2696-8 · PubMed

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5CQE 2.1 Å, 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from…
5EUO 2.1 Å, PF6-M1-HLA-A2
1EA3 2.3 Å, Influenza virus M1 protein
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
7JM3 3.4 Å, Full-length three-dimensional structure of the influenza A virus M1 protein and its…

Browse structure collections

About this viewer

MolViewer shows 6Z5L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.