6Z7T: Nucleotide-free Myosin-II motor domain

Nucleotide-free Myosin-II motor domain. Determined by X-ray diffraction at 1.88 Å resolution. Released 21 Oct 2020.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Dictyostelium discoideum
Chains: 2
Atoms: 12,958
Mol. weight: 182.54 kDa
Ligands: MG
Released: 21 Oct 2020

Explore 6Z7T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z7T contains 76 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	29-31	3
β-strand	33-37	5	1
β-strand	48-55	8	1
β-strand	59-63	5	1
β-strand	69-73	5	1
α-helix	74-76	3
β-strand	79	1	1
α-helix	80-82	3
α-helix	83-85	3
β-strand	90	1	2
α-helix	91-93	3
α-helix	99-110	12
β-strand	116-119	4	2
β-strand	122-126	5	2
α-helix	137-143	7
α-helix	148-150	3
α-helix	155-169	15
β-strand	173-178	6	2
α-helix	185-200	16
α-helix	209-226	18
β-strand	227-228	2	3
β-strand	236-237	2	3
β-strand	240-247	8	2
β-strand	253-261	9	2
α-helix	265-268	4
β-strand	278	1	3
α-helix	279-287	9
α-helix	290-295	6
α-helix	301-303	3
α-helix	305-308	4
α-helix	320-333	14
α-helix	338-355	18
β-strand	360	1	4
β-strand	368	1	4
α-helix	373-382	10
α-helix	386-394	9
β-strand	397	1	5
β-strand	400	1	6
β-strand	403	1	6
β-strand	406	1	5
α-helix	411-440	30
β-strand	448-454	7	2
α-helix	456-458	3
β-strand	464	1	7
α-helix	466-497	32
α-helix	506-510	5
α-helix	511-518	8
α-helix	525-533	9
α-helix	540-551	12
β-strand	558-559	2	7
β-strand	567-572	6	7
β-strand	575-580	6	7
α-helix	584-587	4
α-helix	594-601	8
α-helix	606-613	8
α-helix	630-646	17
β-strand	649-656	8	2
α-helix	669-678	10
α-helix	681-688	8
β-strand	694-697	4	8
α-helix	698-705	8
α-helix	706-708	3
α-helix	719-729	11
α-helix	734-736	3
β-strand	737-739	3	8
β-strand	743-746	4	8
α-helix	750-762	13

Chain B: 38 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	29-31	3
β-strand	33-37	5	9
β-strand	48-55	8	9
β-strand	59-63	5	9
β-strand	69-73	5	9
α-helix	74-76	3
β-strand	78-79	2	9
α-helix	80-82	3
α-helix	83-85	3
β-strand	90	1	10
α-helix	91-93	3
α-helix	99-110	12
β-strand	116-119	4	10
β-strand	122-126	5	10
α-helix	137-143	7
α-helix	148-150	3
α-helix	155-169	15
β-strand	173-178	6	10
α-helix	185-200	16
α-helix	209-226	18
β-strand	227-228	2	11
β-strand	236-237	2	11
β-strand	240-247	8	10
β-strand	253-261	9	10
α-helix	265-268	4
β-strand	278	1	11
α-helix	279-287	9
α-helix	290-295	6
α-helix	301-303	3
α-helix	305-307	3
α-helix	320-333	14
α-helix	338-355	18
β-strand	360-361	2	12
β-strand	367-368	2	12
α-helix	373-382	10
α-helix	386-394	9
β-strand	397-400	4	13
β-strand	403-406	4	13
α-helix	411-440	30
β-strand	448-454	7	10
α-helix	456-458	3
β-strand	464	1	14
α-helix	466-497	32
α-helix	506-510	5
α-helix	511-518	8
α-helix	525-533	9
α-helix	540-551	12
β-strand	558-559	2	14
β-strand	567-572	6	14
β-strand	575-580	6	14
α-helix	584-587	4
α-helix	594-601	8
α-helix	606-613	8
α-helix	630-646	17
β-strand	649-656	8	10
α-helix	669-678	10
α-helix	681-688	8
β-strand	694-697	4	15
α-helix	698-705	8
α-helix	706-708	3
α-helix	719-729	11
α-helix	734-736	3
β-strand	737-739	3	15
β-strand	743-746	4	15
α-helix	750-762	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-2 heavy chain	A, B	protein	788	Dictyostelium discoideum	P08799 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6Z7T_1 Myosin-2 heavy chain (chains A, B)
MHHHHHHHDGTENPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYEC
GEIVSETSDSFTFKTVDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHNLRVR
YNQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDD
RQNQSLLITGESGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAK
TTRNNNSSRFGKFIEIQFNSAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGAT
AEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIA
GILHLGNIKFEKGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHL
NVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQL
CINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALL
DEQSVFPNATDNTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNK
DPLQQDLELCFKDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLASLMATLETTN
PHFVRCIIPNNKQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLA
PNVPRDAEDSQKATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEAREQRLESNEPPM
DFDDDIPF

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Water and common crystallization additives (EDO, PGE, PEG, GOL) are not listed.

Primary citation

Structural and Computational Insights into a Blebbistatin-Bound Myosin•ADP Complex with Characteristics of an ADP-Release Conformation along the Two-Step Myosin Power Stoke. Ewert, W., Franz, P., Tsiavaliaris, G. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21197417 · PubMed

Other PDB entries of the same protein (UniProt P08799 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W9I 1.75 Å, Myosin II Dictyostelium discoideum motor domain S456Y bound with MgADP-BeFx
3MYK 1.84 Å, Insights into the Importance of Hydrogen Bonding in the Gamma-Phosphate Binding Pocket…
1LVK 1.9 Å, X-ray crystal structure of the MG (DOT) 2'(3')-O-(N-methylanthraniloyl) nucleotide bound…
1VOM 1.9 Å, Complex between dictyostelium myosin and mgadp and vanadate at 1.9A resolution
2AKA 1.9 Å, Structure of the nucleotide-free myosin II motor domain from Dictyostelium discoideum…
1W9L 1.95 Å, Myosin II Dictyostelium discoideum motor domain S456E bound with MgADP-AlF4
1D0X 2.0 Å, Dictyostelium myosin S1DC (motor domain fragment) complexed with M-nitrophenyl…
1D0Y 2.0 Å, Dictyostelium myosin S1DC (motor domain fragment) complexed with O-nitrophenyl…
1D0Z 2.0 Å, Dictyostelium myosin S1DC (motor domain fragment) complexed with P-nitrophenyl…
1D1A 2.0 Å, Dictyostelium myosin S1DC (motor domain fragment) complexed with o,p-dinitrophenyl…
1D1B 2.0 Å, Dictyostelium myosin S1DC (motor domain fragment) complexed with o,p-dinitrophenyl…
1MMD 2.0 Å, Truncated head of myosin from dictyostelium discoideum complexed with mgadp-BEF3

Browse structure collections

About this viewer

MolViewer shows 6Z7T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.