6ZBU: NCoR1BBD2-BCL6BTB chimera
Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with the NcoR1 BBD1 corepressor peptide. Determined by X-ray diffraction at 2.46 Å resolution. Released 2 Dec 2020.
- Method
- X-ray diffraction
- Resolution
- 2.46 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 7,421
- Mol. weight
- 108.33 kDa
- Released
- 2 Dec 2020
Explore 6ZBU in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6ZBU contains 41 α-helices and 38 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 1 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 41-45 | 5 | 2 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-62 | 8 | |
| α-helix | 65-68 | 4 | |
| β-strand | 71-73 | 3 | 2 |
| α-helix | 80-92 | 13 | |
| β-strand | 94-97 | 4 | 3 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-126 | 12 | |
Chain B: 8 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | -5--2 | 4 | 4 |
| β-strand | 7-11 | 5 | 3 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 5 |
| β-strand | 41-45 | 5 | 5 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-61 | 7 | |
| α-helix | 66-68 | 3 | |
| β-strand | 71-73 | 3 | 5 |
| α-helix | 74-75 | 2 | |
| α-helix | 80-92 | 13 | |
| β-strand | 94-97 | 4 | 1 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-126 | 12 | |
Chains C, D, G and K: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1343-1346 | 4 | 3 |
Chain E: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 6 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 4 |
| β-strand | 41-45 | 5 | 4 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-61 | 7 | |
| β-strand | 71-74 | 4 | 4 |
| α-helix | 80-92 | 13 | |
| β-strand | 94-98 | 5 | 7 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-126 | 12 | |
Chain F: 7 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | -4--3 | 2 | 2 |
| β-strand | 6-11 | 6 | 7 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 8 |
| β-strand | 41-45 | 5 | 8 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-62 | 8 | |
| α-helix | 64-67 | 4 | |
| β-strand | 71-73 | 3 | 8 |
| α-helix | 80-92 | 13 | |
| β-strand | 94-97 | 4 | 6 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-123 | 9 | |
Chains H and L: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1342-1346 | 5 | 6 |
Chain I: 7 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-11 | 5 | 9 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 10 |
| β-strand | 41-45 | 5 | 10 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-62 | 8 | |
| α-helix | 66-68 | 3 | |
| β-strand | 71-73 | 3 | 10 |
| α-helix | 80-92 | 13 | |
| β-strand | 94-98 | 5 | 11 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-126 | 12 | |
Chain J: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-11 | 6 | 11 |
| α-helix | 14-27 | 14 | |
| β-strand | 34-38 | 5 | 12 |
| β-strand | 41-45 | 5 | 12 |
| α-helix | 47-53 | 7 | |
| α-helix | 55-62 | 8 | |
| β-strand | 71-73 | 3 | 12 |
| α-helix | 80-92 | 13 | |
| β-strand | 94-97 | 4 | 9 |
| α-helix | 102-111 | 10 | |
| α-helix | 115-123 | 9 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Nuclear receptor corepressor 1,B-cell lymphoma 6 protein | A, B, E, F, I, J | protein | 137 | Homo sapiens | O75376 (AlphaFold model), P41182 (AlphaFold model) |
| Nuclear receptor corepressor 1 | C, D, G, H, K, L | protein | 17 | Homo sapiens | O75376 (AlphaFold model) |
Sequence of entity 1 (A, B, E, F, I, J), FASTA
>6ZBU_1 Nuclear receptor corepressor 1,B-cell lymphoma 6 protein (chains A, B, E, F, I, J)
GPSSDLYLRPGGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMA
CSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYL
QMEHVVDTCRKFIKASE
Sequence of entity 2 (C, D, G, H, K, L), FASTA
>6ZBU_2 Nuclear receptor corepressor 1 (chains C, D, G, H, K, L)
GITTIKEMGRSIHEIPR
Primary citation
Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone. Zacharchenko, T., Wright, S. IUCrJ (2021) 8:154-160. DOI 10.1107/S2052252520015754 · PubMed
Other PDB entries of the same protein (UniProt O75376 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6XZZ 1.39 Å, Crystal structure of the BCL6 BTB domain in complex with the NCoR1 BBD2 peptide
- 8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
- 6XYX 1.44 Å, Crystal structure of the BCL6 BTB domain in complex with the NCoR1 BBD corepressor peptide
- 6Y17 1.56 Å, Crystal structure of an NCoR1BBD2-BCL6BTB chimera in complex with nebulinSH3-NCoR1BBD1
- 8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
- 6ONI 1.8 Å, Crystal structure of PPARgamma ligand binding domain in complex with N-CoR peptide and…
- 8FHE 1.8 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
- 8FHG 1.8 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
- 8FKF 1.82 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
- 8DKN 1.95 Å, PPARg bound to T0070907 and Co-R peptide
- 6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
- 8FKE 2.02 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
Browse structure collections
About this viewer
MolViewer shows 6ZBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.