RIFIN variable region bound to LILRB1 ectodomain. Determined by X-ray diffraction at 3.0 Å resolution. Released 22 Jul 2020.
Explore 6ZDX in 3D Show helices and sheets RCSB PDB PDBe
6ZDX contains 20 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 166-181 | 16 | |
| α-helix | 186-190 | 5 | |
| α-helix | 191-197 | 7 | |
| α-helix | 200-204 | 5 | |
| α-helix | 208-220 | 13 | |
| α-helix | 224-226 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 235 | 1 | 1 |
| α-helix | 242-259 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| β-strand | 7-11 | 5 | 2 |
| β-strand | 15-17 | 3 | 3 |
| β-strand | 22-27 | 6 | 2 |
| β-strand | 36-39 | 4 | 4 |
| α-helix | 45-49 | 5 | |
| α-helix | 52-55 | 4 | |
| β-strand | 59-62 | 4 | 2 |
| β-strand | 71-76 | 6 | 4 |
| α-helix | 85-90 | 6 | |
| β-strand | 91-93 | 3 | 4 |
| β-strand | 94-96 | 3 | 3 |
| β-strand | 99 | 1 | 1 |
| β-strand | 103-107 | 5 | 5 |
| β-strand | 111-113 | 3 | 6 |
| β-strand | 118-123 | 6 | 5 |
| β-strand | 130-136 | 7 | 7 |
| α-helix | 141-142 | 2 | |
| β-strand | 143-147 | 5 | 7 |
| α-helix | 152-154 | 3 | |
| β-strand | 156-161 | 6 | 5 |
| β-strand | 171-177 | 7 | 7 |
| β-strand | 184 | 1 | 3 |
| β-strand | 185 | 1 | 7 |
| α-helix | 187-191 | 5 | |
| β-strand | 192-193 | 2 | 7 |
| β-strand | 195-197 | 3 | 6 |
| β-strand | 204-208 | 5 | 8 |
| β-strand | 212-213 | 2 | 9 |
| β-strand | 219-225 | 7 | 8 |
| β-strand | 231-236 | 6 | 10 |
| β-strand | 243-245 | 3 | 10 |
| α-helix | 247-250 | 4 | |
| β-strand | 255-261 | 7 | 8 |
| α-helix | 266-268 | 3 | |
| β-strand | 270-277 | 8 | 10 |
| β-strand | 284 | 1 | 6 |
| α-helix | 285-290 | 6 | |
| β-strand | 291-293 | 3 | 10 |
| β-strand | 294-295 | 2 | 9 |
| β-strand | 304-307 | 4 | 11 |
| β-strand | 312-313 | 2 | 12 |
| β-strand | 318-325 | 8 | 11 |
| β-strand | 331-336 | 6 | 13 |
| α-helix | 342-343 | 2 | |
| β-strand | 344-347 | 4 | 13 |
| β-strand | 349-351 | 3 | 11 |
| β-strand | 354-363 | 10 | 11 |
| β-strand | 370-377 | 8 | 13 |
| β-strand | 378 | 1 | 14 |
| β-strand | 381 | 1 | 14 |
| β-strand | 384 | 1 | 9 |
| α-helix | 387-391 | 5 | |
| β-strand | 392-394 | 3 | 13 |
| β-strand | 395-396 | 2 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rifin | A | protein | 129 | Plasmodium falciparum 3D7 | Q8I4N9 (AlphaFold model) |
| Leukocyte immunoglobulin-like receptor subfamily B member 1 | B | protein | 437 | Homo sapiens | Q8NHL6 (AlphaFold model) |
>6ZDX_1 Rifin (chains A) GSSHHHHHHSSGLVPRGSHMNYETINAFIAKTIEELEGIPGITKLFGAKISQFVTPAVFR KPMSLVETILSEKKKLCLCAANKNELLCRGMNPNVPETLPKKIEVAVNEVLSSVNDTWAT ATTPTTFFT
>6ZDX_2 Leukocyte immunoglobulin-like receptor subfamily B member 1 (chains B) MGILPSPGMPALLSLVSLLSVLLMGCVAETGGHLPKPTLWAEPGSVITQGSPVTLRCQGG QETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSD PLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQP HARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQP GPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYG GQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWM QTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPS DPLELVVSGTKHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structural basis for RIFIN-mediated activation of LILRB1 in malaria. Harrison, T.E., Morch, A.M., Felce, J.H. et al. Nature (2020) 587:309-312. DOI 10.1038/s41586-020-2530-3 · PubMed
MolViewer shows 6ZDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.