6ZN3: Myosin essential light chain ELC

Plasmodium facliparum glideosome trimeric sub-complex. Determined by X-ray diffraction at 2.51 Å resolution. Released 21 Oct 2020.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: Plasmodium falciparum 3D7
Chains: 15
Atoms: 12,968
Mol. weight: 188.05 kDa
Released: 21 Oct 2020

Explore 6ZN3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZN3 contains 106 α-helices and 47 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-17	17
β-strand	22-23	2	1
α-helix	25-34	10
α-helix	41-46	6
β-strand	51-52	2	1
α-helix	53-63	11
α-helix	71-74	4
α-helix	76-79	4
β-strand	85-86	2	2
α-helix	87-96	10
α-helix	103-113	11
β-strand	120-121	2	2
α-helix	123-132	10

Chain B: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	66-71	6
α-helix	74-84	11
β-strand	86	1	3
β-strand	89-91	3	3
α-helix	92-101	10
α-helix	108-118	11
β-strand	121-123	3	3
α-helix	124-133	10
α-helix	141-144	4
α-helix	146-151	6
β-strand	158-160	3	4
α-helix	161-170	10
α-helix	174-176	3
α-helix	177-187	11
β-strand	192-194	3	4
α-helix	195-203	9

Chains C and I: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	775-798	24
α-helix	801-814	14

Chain D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-4	4
α-helix	6-17	12
β-strand	22-23	2	5
α-helix	25-34	10
α-helix	41-44	4
β-strand	51-52	2	5
α-helix	53-63	11
β-strand	85-86	2	6
α-helix	87-96	10
α-helix	103-113	11
β-strand	120-121	2	6
α-helix	123-132	10

Chain E: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	63-71	9
α-helix	74-84	11
β-strand	86	1	7
β-strand	89	1	7
β-strand	90-91	2	8
α-helix	92-101	10
α-helix	108-118	11
β-strand	121-122	2	8
α-helix	124-133	10
α-helix	141-144	4
α-helix	146-151	6
β-strand	158-160	3	9
α-helix	161-170	10
α-helix	174-176	3
α-helix	177-185	9
β-strand	192-194	3	9
α-helix	195-203	9

Chains F and L: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	775-799	25
α-helix	801-814	14

Chain G: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-17	17
β-strand	22	1	10
α-helix	25-34	10
α-helix	41-46	6
β-strand	52	1	10
α-helix	53-63	11
α-helix	71-74	4
β-strand	84-86	3	11
α-helix	87-96	10
α-helix	103-113	11
β-strand	120-122	3	11
α-helix	123-132	10

Chain H: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	66-71	6
α-helix	74-84	11
β-strand	86	1	12
β-strand	89	1	12
β-strand	90-91	2	13
α-helix	92-101	10
α-helix	108-118	11
β-strand	121-122	2	13
α-helix	124-133	10
α-helix	141-144	4
α-helix	146-151	6
β-strand	158-160	3	14
α-helix	161-170	10
α-helix	174-176	3
α-helix	177-185	9
β-strand	192-194	3	14
α-helix	195-203	9

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin essential light chain ELC	A, D, G, J, M	protein	135	Plasmodium falciparum 3D7	Q8IJM4 (AlphaFold model)
Myosin A tail domain interacting protein	B, E, H, K, N	protein	147	Plasmodium falciparum 3D7	Q8I4W8 (AlphaFold model)
Myosin-A	C, F, I, L, O	protein	43	Plasmodium falciparum 3D7	Q8IDR3 (AlphaFold model)

Sequence of entity 1 (A, D, G, J, M), FASTA

>6ZN3_1 Myosin essential light chain ELC (chains A, D, G, J, M)
SMASDMEEKFREAFILFSSCSDHIEMYKFFELMNSFGIILTNDEKAALPNDINMDYWLNF
AKKHYNYEQPFKHINNVNEQNTNVQIKIDNFLGIMKALDTRLTESDLNILLQITNPENKS
TLNLKTVSQKLTESI

Sequence of entity 2 (B, E, H, K, N), FASTA

>6ZN3_2 Myosin A tail domain interacting protein (chains B, E, H, K, N)
SMESVADIQQLEEKVDESDVRIYFNEKSSGGKISIDNASYNARKLGLAPSSIDEKKIKEL
YGDNLTYEQYLEYLSICVHDKDNVEELIKMFAHFDNNCTGYLTKSQMKNILTTWGDALTD
QEAIDALNAFSSEDNIDYKLFCEDILQ

Sequence of entity 3 (C, F, I, L, O), FASTA

>6ZN3_3 Myosin-A (chains C, F, I, L, O)
SVEWENCVSVIEAAILKHKYKQKVNKNIPSLLRVQAHIRKKMV

Primary citation

Structural role of essential light chains in the apicomplexan glideosome. Pazicky, S., Dhamotharan, K., Kaszuba, K. et al. Commun Biol (2020) 3:568-568. DOI 10.1038/s42003-020-01283-8 · PubMed

Other PDB entries of the same protein (UniProt Q8IJM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TJ4 1.5 Å, P. falciparum essential light chain, N-terminal domain
8A12 2.03 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to Mg.ATP-gamma-S
8CDQ 2.21 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
8CDM 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state complexed to the inhibitor…
9T7I 2.35 Å, Plasmodium falciparum Myosin A full-length, post-rigor state, complexed to the inhibitor…
6YCY 2.55 Å, Plasmodium falciparum Myosin A full-length, post-rigor state
6YCZ 3.27 Å, Plasmodium falciparum Myosin A delta-Nter, Post-Rigor state
6YCX 3.99 Å, Plasmodium falciparum Myosin A full-length, pre-powerstroke state
6TJ3 P. falciparum essential light chain, N-terminal domain

Browse structure collections

About this viewer

MolViewer shows 6ZN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.