EYFP mutant - F165G. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Jun 2021.
Explore 6ZQO in 3D Show helices and sheets RCSB PDB PDBe
6ZQO contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 11-22 | 12 | 1 |
| β-strand | 25-36 | 12 | 1 |
| β-strand | 41-48 | 8 | 1 |
| α-helix | 57-60 | 4 | |
| α-helix | 67-69 | 3 | |
| β-strand | 71 | 1 | 1 |
| α-helix | 74-79 | 6 | |
| α-helix | 81-84 | 4 | |
| β-strand | 90-98 | 9 | 1 |
| β-strand | 103-112 | 10 | 1 |
| β-strand | 117-126 | 10 | 1 |
| β-strand | 139 | 1 | 2 |
| β-strand | 146-153 | 8 | 1 |
| α-helix | 154-156 | 3 | |
| β-strand | 158-168 | 11 | 1 |
| β-strand | 169 | 1 | 2 |
| β-strand | 174-185 | 12 | 1 |
| α-helix | 194-195 | 2 | |
| β-strand | 197-206 | 10 | 1 |
| β-strand | 215-225 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| G protein/GFP fusion protein | A | protein | 249 | Recombinant vesicular stomatitis Indiana virus rVSV-G/GFP | B7UCZ6 |
>6ZQO_1 G protein/GFP fusion protein (chains A) MRGSHHHHHHGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFI CTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYK TRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNGKI RHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAA GITLGMDELYK
Amino acid residue at the 165th position tunes EYFP chromophore maturation. A structure-based design. Pletneva, N.V., Maksimov, E.G., Protasova, E.A. et al. Comput Struct Biotechnol J (2021) 19:2950-2959. DOI 10.1016/j.csbj.2021.05.017 · PubMed
Other PDB entries of the same protein (UniProt B7UCZ6), best resolution first:
MolViewer shows 6ZQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.