6ZQS: Double-phosphorylated p38alpha with ATF2(83-102)

Name: PDB 6ZQS: Crystal structure of double-phosphorylated p38alpha with ATF2(83-102)
Published: 2020-11-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of double-phosphorylated p38alpha with ATF2(83-102). Determined by X-ray diffraction at 1.95 Å resolution. Released 18 Nov 2020.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,268
Mol. weight: 44.37 kDa
Ligands: 3FF
Released: 18 Nov 2020

Explore 6ZQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZQS contains 25 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	8-12	5	1
β-strand	17-21	5	1
β-strand	24-29	6	2
α-helix	30-33	4
β-strand	38-43	6	2
β-strand	48-54	7	2
α-helix	62-77	16
β-strand	83	1	3
β-strand	88-90	3	2
α-helix	96-98	3
β-strand	103-107	5	2
β-strand	112	1	3
α-helix	113-117	5
α-helix	124-143	20
β-strand	146-147	2	4
α-helix	153-155	3
β-strand	156-158	3	3
β-strand	164-166	3	3
β-strand	173-174	2	4
α-helix	186-188	3
α-helix	191-195	5
α-helix	203-218	16
α-helix	228-239	12
α-helix	244-247	4
α-helix	253-260	8
α-helix	263-264	2
α-helix	266-268	3
α-helix	270-272	3
α-helix	279-288	10
α-helix	293-295	3
α-helix	297-298	2
α-helix	299-303	5
α-helix	306-308	3
α-helix	320-324	5
α-helix	334-346	13
α-helix	350-352	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	91-100	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 14	A	protein	362	Homo sapiens	Q16539 (AlphaFold model)
Cyclic AMP-dependent transcription factor ATF-2	B	protein	20	Homo sapiens	P15336 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZQS_1 Mitogen-activated protein kinase 14 (chains A)
GSMSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRP
FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK
CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDE
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRL
VGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRIT
AAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEM
ES

Sequence of entity 2 (B), FASTA

>6ZQS_2 Cyclic AMP-dependent transcription factor ATF-2 (chains B)
GLFNELANPFENEFKKASED

Ligands and cofactors

ID	Name	Formula	Copies
3FF	2-[(2,4-difluorophenyl)amino]-7-{[(2R)-2,3-dihydroxypropyl]oxy}-10,11-dihydro-5…	C24 H21 F2 N O4	1

Primary citation

Co-regulation of the transcription controlling ATF2 phosphoswitch by JNK and p38. Kirsch, K., Zeke, A., Toke, O. et al. Nat Commun (2020) 11:5769-5769. DOI 10.1038/s41467-020-19582-3 · PubMed

Other PDB entries of the same protein (UniProt Q16539 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FST 1.45 Å, mitogen activated protein kinase p38alpha (D176A+F327L) activating mutant
3LFF 1.5 Å, Human p38 MAP Kinase in Complex with RL166
3OEF 1.6 Å, Crystal structure of Y323F inactive mutant of p38alpha MAP kinase
3ZS5 1.6 Å, Structural basis for kinase selectivity of three clinical p38alpha inhibitors
4EHV 1.6 Å, Human p38 MAP kinase in complex with NP-F10 and RL87
5WJJ 1.6 Å, Structure-based Design, Synthesis, and Biological Evaluation of…
6SFI 1.6 Å, Crystal structure of p38 alpha in complex with compound 75 (MCP33)
9MHB 1.65 Å, Crystal Structure of Human P38 alpha MAPK In Complex with MW01-14-064SRM
4GEO 1.66 Å, P38a MAP kinase DEF-pocket penta mutant (M194A, L195A, H228A, I229A, Y258A)
6QYX 1.66 Å, p38(alpha) MAP kinase with the activation loop of ERK2
8YD9 1.66 Å, Crystal structure of p38alpha with an allosteric inhibitor 3
2FSL 1.7 Å, mitogen activated protein kinase p38alpha (D176A+F327S) activating mutant form-A

Browse structure collections

About this viewer

MolViewer shows 6ZQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.