14-3-3 Sigma in complex with phosphorylated Gab2pT391 peptide - 1h incubation. Determined by X-ray diffraction at 2.51 Å resolution. Released 4 Aug 2021.
Explore 6ZVE in 3D Show helices and sheets RCSB PDB PDBe
6ZVE contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 38-68 | 31 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-117 | 4 | |
| α-helix | 121-134 | 14 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-172 | 6 | |
| α-helix | 176-179 | 4 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 388-390 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 253 | Homo sapiens | P31947 (AlphaFold model) |
| phosphorylated Gab2pT391 peptide | P | protein | 13 | Homo sapiens | Q9UQC2 (AlphaFold model) |
>6ZVE_1 14-3-3 protein sigma (chains A) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS
>6ZVE_2 phosphorylated Gab2pT391 peptide (chains P) IPRRNTLPAMDNS
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
A new soaking procedure for X-ray crystallography structural determination of protein-peptide complexes. Ballone, A., Lau, R.A., Zweipfenning, F.P.A. et al. To be published.
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZVE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.