7A6R: 14-3-3 gamma
Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding motif. Determined by X-ray diffraction at 2.7 Å resolution. Released 25 Aug 2021.
- Method
- X-ray diffraction
- Resolution
- 2.7 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 7,409
- Mol. weight
- 112.53 kDa
- Released
- 25 Aug 2021
Explore 7A6R in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7A6R contains 54 α-helices and 0 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-16 | 12 | |
| α-helix | 20-32 | 13 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-69 | 31 | |
| α-helix | 76-103 | 28 | |
| α-helix | 104-108 | 5 | |
| α-helix | 117-137 | 21 | |
| α-helix | 141-164 | 24 | |
| α-helix | 170-181 | 12 | |
| α-helix | 182-186 | 5 | |
| α-helix | 190-206 | 17 | |
| α-helix | 208-210 | 3 | |
| α-helix | 216-233 | 18 | |
Chain B: 11 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-16 | 13 | |
| α-helix | 20-32 | 13 | |
| α-helix | 39-69 | 31 | |
| α-helix | 79-103 | 25 | |
| α-helix | 104-108 | 5 | |
| α-helix | 117-135 | 19 | |
| α-helix | 140-163 | 24 | |
| α-helix | 170-181 | 12 | |
| α-helix | 182-186 | 5 | |
| α-helix | 190-205 | 16 | |
| α-helix | 216-232 | 17 | |
Chain C: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-16 | 13 | |
| α-helix | 20-32 | 13 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-73 | 35 | |
| α-helix | 76-103 | 28 | |
| α-helix | 104-108 | 5 | |
| α-helix | 117-137 | 21 | |
| α-helix | 141-164 | 24 | |
| α-helix | 170-181 | 12 | |
| α-helix | 182-186 | 5 | |
| α-helix | 190-205 | 16 | |
| α-helix | 208-210 | 3 | |
| α-helix | 213-232 | 20 | |
Chain D: 14 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-16 | 13 | |
| α-helix | 20-32 | 13 | |
| α-helix | 36-38 | 3 | |
| α-helix | 39-73 | 35 | |
| α-helix | 76-103 | 28 | |
| α-helix | 104-108 | 5 | |
| α-helix | 109-111 | 3 | |
| α-helix | 117-137 | 21 | |
| α-helix | 141-164 | 24 | |
| α-helix | 170-181 | 12 | |
| α-helix | 182-186 | 5 | |
| α-helix | 190-206 | 17 | |
| α-helix | 213-215 | 3 | |
| α-helix | 216-233 | 18 | |
Chains E and G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 366-368 | 3 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 365-368 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 14-3-3 protein gamma | A, B, C, D | protein | 236 | Homo sapiens | P61981 (AlphaFold model) |
| DAPK2 C-terminal peptide | E, F, G, L | protein | 7 | Homo sapiens | Q9UIK4 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>7A6R_1 14-3-3 protein gamma (chains A, B, C, D)
GHMVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRS
SWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYE
SKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALN
YSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWT
Sequence of entity 2 (E, F, G, L), FASTA
>7A6R_2 DAPK2 C-terminal peptide (chains E, F, G, L)
RRRSSTS
Primary citation
14-3-3 proteins inactivate DAPK2 by promoting its dimerization and protecting key regulatory phosphosites. Horvath, M., Petrvalska, O., Herman, P. et al. Commun Biol (2021) 4:986-986. DOI 10.1038/s42003-021-02518-y · PubMed
Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
- 6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
- 3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
- 6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
- 6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
- 4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
- 7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
- 2B05 2.55 Å, Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
- 6GKF 2.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139
- 6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
- 5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795
- 6SAD 2.75 Å, Structure of 14-3-3 gamma in complex with double phosphorylated caspase-2 peptide on…
Browse structure collections
About this viewer
MolViewer shows 7A6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.