6GKF: 14-3-3 gamma

Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139. Determined by X-ray diffraction at 2.6 Å resolution. Released 17 Oct 2018.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 16
Atoms: 14,108
Mol. weight: 224.28 kDa
Released: 17 Oct 2018

Explore 6GKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GKF contains 97 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	39-69	31
α-helix	78-103	26
α-helix	104-108	5
α-helix	117-135	19
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	217-232	16

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	35-37	3
α-helix	39-69	31
α-helix	71-73	3
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-137	21
α-helix	141-164	24
α-helix	170-185	16
α-helix	190-205	16
α-helix	216-232	17

Chain C: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-37	2
α-helix	39-71	33
α-helix	77-103	27
α-helix	104-108	5
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-233	18

Chain D: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-37	2
α-helix	39-70	32
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-135	19
α-helix	140-164	25
α-helix	170-185	16
α-helix	190-206	17
α-helix	217-233	17

Chain E: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-73	35
α-helix	78-103	26
α-helix	104-108	5
α-helix	117-137	21
α-helix	140-164	25
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-205	16
α-helix	208-210	3
α-helix	217-232	16

Chain F: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-37	2
α-helix	39-70	32
α-helix	79-103	25
α-helix	104-108	5
α-helix	117-137	21
α-helix	141-163	23
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-205	16
α-helix	217-231	15

Chain G: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	36-38	3
α-helix	39-69	31
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-135	19
α-helix	141-164	24
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-205	16
α-helix	221-233	13

Chain H: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-32	13
α-helix	35-37	3
α-helix	39-67	29
α-helix	78-103	26
α-helix	104-108	5
α-helix	117-135	19
α-helix	141-164	24
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	217-233	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein gamma	A, B, C, D, E, F, G, H	protein	234	Homo sapiens	P61981 (AlphaFold model)
Caspase-2	I, J, K, L, M, N, O, P	protein	8	Homo sapiens	P42575 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>6GKF_1 14-3-3 protein gamma (chains A, B, C, D, E, F, G, H)
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (I, J, K, L, M, N, O, P), FASTA

>6GKF_2 Caspase-2 (chains I, J, K, L, M, N, O, P)
YDLSLPFP

Primary citation

14-3-3 protein masks the nuclear localization sequence of caspase-2. Smidova, A., Alblova, M., Kalabova, D. et al. FEBS J (2018) 285:4196-4213. DOI 10.1111/febs.14670 · PubMed

Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
2B05 2.55 Å, Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
7A6R 2.7 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding…
5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795
6SAD 2.75 Å, Structure of 14-3-3 gamma in complex with double phosphorylated caspase-2 peptide on…

Browse structure collections

About this viewer

MolViewer shows 6GKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.