Crystal structure of RXR alpha LBD in complexes with palmitic acid and GRIP-1 peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Oct 2020.
Explore 7A77 in 3D Show helices and sheets RCSB PDB PDBe
7A77 contains 16 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 226-229 | 4 | |
| α-helix | 232-242 | 11 | |
| β-strand | 250-251 | 2 | 1 |
| α-helix | 264-284 | 21 | |
| α-helix | 289-291 | 3 | |
| α-helix | 294-316 | 23 | |
| α-helix | 317-319 | 3 | |
| β-strand | 323-325 | 3 | 1 |
| β-strand | 330-333 | 4 | 1 |
| α-helix | 334-339 | 6 | |
| α-helix | 343-348 | 6 | |
| α-helix | 349-354 | 6 | |
| α-helix | 355-360 | 6 | |
| α-helix | 364-375 | 12 | |
| α-helix | 386-407 | 22 | |
| α-helix | 414-419 | 6 | |
| α-helix | 422-442 | 21 | |
| α-helix | 449-454 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 473-480 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Retinoic acid receptor RXR-alpha | A | protein | 242 | Homo sapiens | P19793 (AlphaFold model) |
| Nuclear receptor coactivator 2 | B | protein | 14 | Homo sapiens | Q15596 (AlphaFold model) |
>7A77_1 Retinoic acid receptor RXR-alpha (chains A) SMTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSA GVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASL EAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQ MT
>7A77_2 Nuclear receptor coactivator 2 (chains B) KHKILHRLLQDSSY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLM | Palmitic acid | C16 H32 O2 | 1 |
Water and common crystallization additives (CL, EDO) are not listed.
Comprehensive Set of Tertiary Complex Structures and Palmitic Acid Binding Provide Molecular Insights into Ligand Design for RXR Isoforms. Chaikuad, A., Pollinger, J., Ruhl, M. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21228457 · PubMed
Other PDB entries of the same protein (UniProt P19793 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7A77 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.