7A9B: Shank1 PDZ domain with ARAP3-derived peptide

Crystal structure of Shank1 PDZ domain with ARAP3-derived peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Oct 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 1,992
Mol. weight: 30.18 kDa
Released: 21 Oct 2020

Explore 7A9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7A9B contains 10 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	657-667	11	1
β-strand	676-681	6	1
α-helix	685-689	5
β-strand	700-705	6	1
α-helix	710-713	4
α-helix	720	1
β-strand	721-725	5	1
β-strand	728-729	2	1
α-helix	735-744	10
β-strand	748-758	11	1
α-helix	759-761	3
β-strand	779-783	5	2

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	654-667	14	2
β-strand	676-681	6	2
β-strand	693	1	3
β-strand	696	1	3
β-strand	700-705	6	2
α-helix	710-714	5
α-helix	720	1
β-strand	721-725	5	2
β-strand	728-729	2	2
α-helix	735-744	10
β-strand	748-761	14	2
α-helix	763-765	3
β-strand	776	1	2
α-helix	777-778	2
β-strand	779-783	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 and multiple ankyrin repeat domains protein 1,Arf-GAP with Rho-GAP domain, ANK repeat and PH…	A, B	protein	140	Rattus norvegicus, Homo sapiens	Q8WWN8 (AlphaFold model), Q9WV48 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7A9B_1 SH3 and multiple ankyrin repeat domains protein 1,Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 (chains A, B)
GAMGPGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEG
GVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTRHPDMDAAAGS
GSGSFPELIQDTSTSFSTTR

Primary citation

Integrated analysis of Shank1 PDZ interactions with C-terminal and internal binding motifs. Ali, M., McAuley, M.M., Luchow, S. et al. Curr Res Struct Biol (2021) 3:41-50. DOI 10.1016/j.crstbi.2021.01.001 · PubMed

Other PDB entries of the same protein (UniProt Q8WWN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YIR 2.1 Å, Crystal structure of N-terminal PH domain of ARAP3 protein from human
5JCP 2.1 Å, RhoGAP domain of ARAP3 in complex with RhoA in the transition state
5JD0 2.3 Å, crystal structure of ARAP3 RhoGAP domain
7YIS 3.3 Å, Crystal structure of N-terminal PH domain of ARAP3 protein in complex with inositol…
2KG5 NMR Solution structure of ARAP3-SAM
2LNW Identification and structural basis for a novel interaction between Vav2 and Arap3

Browse structure collections

About this viewer

MolViewer shows 7A9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.