7ABS: Human DCLRE1C/Artemis

Structure of human DCLRE1C/Artemis in complex with DNA - re-evaluation of 6WO0. Determined by X-ray diffraction at 1.97 Å resolution. Released 4 Aug 2021.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,282
Mol. weight: 50.47 kDa
Ligands: ZN
Released: 4 Aug 2021

Explore 7ABS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ABS contains 18 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	14-16	3	1
α-helix	21-25	5
β-strand	28-30	3	1
α-helix	36-38	3
α-helix	45-53	9
β-strand	59-61	3	1
α-helix	63-69	7
α-helix	73-78	6
β-strand	82-84	3	1
β-strand	91-96	6	2
β-strand	103-112	10	2
β-strand	120-127	8	2
β-strand	129-133	5	2
α-helix	144-146	3
α-helix	148-150	3
β-strand	151-152	2	3
β-strand	155-156	2	3
β-strand	161-164	4	2
α-helix	171-173	3
β-strand	175	1	4
α-helix	179-194	16
β-strand	200-204	5	5
α-helix	213-223	11
α-helix	226	1
β-strand	227-228	2	5
α-helix	233-235	3
α-helix	239-242	4
β-strand	245-246	2	5
β-strand	253-254	2	5
α-helix	261-266	6
β-strand	276-277	2	6
β-strand	280-281	2	6
α-helix	282	1
β-strand	283-289	7	5
β-strand	294	1	4
β-strand	304-308	5	5
β-strand	311-314	4	5
α-helix	322-332	11
β-strand	336-339	4	2
α-helix	348-355	8
α-helix	356-358	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein artemis	A	protein	375	Homo sapiens	Q96SD1 (AlphaFold model)
DNA (5'-d(pgpcpgpaptpcpapgpcpt)-3')	B	DNA	10	Homo sapiens
DNA (5'-d(cpapgpc)-3')	E	DNA	13	Homo sapiens

Sequence of entity 1 (A), FASTA

>7ABS_1 Protein artemis (chains A)
SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYC
SPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVM
FLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSREE
CLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPEI
LHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRKT
NVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCRS
SQSTEPKKGENLYFQ

Sequence of entity 2 (B), FASTA

>7ABS_2 DNA (5'-D(P*GP*CP*GP*AP*TP*CP*AP*GP*CP*T)-3') (chains B)
GCGATCAGCT

Sequence of entity 3 (E), FASTA

>7ABS_3 DNA (5'-D(*CP*AP*GP*C)-3') (chains E)
CACAGCTGATCGC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Structural and mechanistic insights into the Artemis endonuclease and strategies for its inhibition. Yosaatmadja, Y., Baddock, H.T., Newman, J.A. et al. Nucleic Acids Res (2021) 49:9310-9326. DOI 10.1093/nar/gkab693 · PubMed

Other PDB entries of the same protein (UniProt Q96SD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TT5 1.5 Å, Crystal structure of DCLRE1C/Artemis
7AFU 1.56 Å, The structure of Artemis variant H33A
7AF1 1.7 Å, The structure of Artemis/SNM1C/DCLRE1C with 2 Zinc ions
7AFS 1.7 Å, The structure of Artemis variant D37A
7AGI 1.7 Å, The structure of Artemis variant H35D
7APV 1.95 Å, Structure of Artemis/DCLRE1C/SNM1C in complex with Ceftriaxone
6WO0 1.97 Å, human Artemis/SNM1C catalytic domain, crystal form 1
4HTP 2.25 Å, Crystal structure of the DBD domain of human DNA ligase IV bound to Artemis peptide
6WNL 2.37 Å, human Artemis/SNM1C catalytic domain, crystal form 2
3W1B 2.4 Å, Crystal Structure of Human DNA ligase IV-Artemis Complex (Mercury Derivative)
3W1G 2.55 Å, Crystal Structure of Human DNA ligase IV-Artemis Complex (Native)
7SGL 3.0 Å, DNA-PK complex of DNA end processing

Browse structure collections

About this viewer

MolViewer shows 7ABS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.