7ACN: Aconitase

Crystal structures of aconitase with isocitrate and nitroisocitrate bound. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Sus scrofa
Chains: 1
Atoms: 6,174
Mol. weight: 83.33 kDa
Ligands: SF4, ICT
Released: 31 Oct 1993

Explore 7ACN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ACN contains 44 α-helices and 48 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 48 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	15	1	1
α-helix	18-32	15
α-helix	38-44	7
β-strand	47	1	2
β-strand	61-64	4	2
β-strand	68-72	5	3
α-helix	73-86	14
β-strand	95-98	4	3
β-strand	105	1	4
α-helix	109-119	11
α-helix	121-134	14
β-strand	137-139	3	3
β-strand	144	1	5
α-helix	146-153	8
β-strand	160-163	4	3
α-helix	168-174	7
β-strand	177-180	4	3
α-helix	183-190	8
α-helix	193-194	2
β-strand	195-198	4	2
α-helix	199-200	2
β-strand	201-208	8	6
α-helix	217-228	12
β-strand	236-241	6	6
α-helix	243-247	5
α-helix	250-259	10
α-helix	260-263	4
β-strand	267-269	3	6
α-helix	274-282	9
α-helix	286-294	9
α-helix	296-299	4
α-helix	301-302	2
α-helix	305-307	3
β-strand	309-314	6	6
α-helix	315-317	3
β-strand	321-323	3	7
β-strand	331-333	3	7
α-helix	334-344	11
β-strand	349	1	8
β-strand	350-355	6	7
α-helix	363-377	15
β-strand	386-389	4	7
β-strand	393	1	5
α-helix	394-402	9
α-helix	405-411	7
β-strand	414-416	3	7
α-helix	417-418	2
α-helix	422-425	4
β-strand	428	1	4
β-strand	439-443	5	7
β-strand	459-463	5	7
α-helix	466-475	10
β-strand	477	1	8
α-helix	485-486	2
β-strand	487-488	2	9
β-strand	494-495	2	9
α-helix	497-500	4
α-helix	509-511	3
β-strand	517-518	2	3
α-helix	519-521	3
α-helix	527-529	3
β-strand	538	1	10
α-helix	540-547	8
β-strand	552-560	9	11
β-strand	561	1	12
β-strand	566	1	13
α-helix	567-570	4
α-helix	574-579	6
β-strand	581	1	10
α-helix	583-586	4
α-helix	587-589	3
β-strand	595-596	2	12
β-strand	601-602	2	12
β-strand	605-606	2	14
β-strand	613-614	2	14
α-helix	616-625	10
β-strand	630-633	4	11
β-strand	638	1	15
β-strand	640	1	13
α-helix	646-653	8
β-strand	656-661	6	11
β-strand	664	1	15
α-helix	666-674	9
β-strand	678-682	5	11
α-helix	685-690	6
β-strand	696-700	5	11
α-helix	702-704	3
β-strand	711-716	6	11
β-strand	722-728	7	11
α-helix	733-741	9
α-helix	744-751	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aconitase	A	protein	754	Sus scrofa	P16276 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ACN_1 ACONITASE (chains A)
QRAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKT
YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDIN
QEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIG
VGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEY
HGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLV
PDPGCHYDQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTN
SSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANA
CGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKF
NPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQL
LEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENR
KANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYGEGSSREHSALEPRHLGGRAII
TKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNG
TQETILLNHTFNETQIEWFRAGSALNRMKELQQK

Ligands and cofactors

ID	Name	Formula	Copies
SF4	Iron/sulfur cluster	Fe4 S4	1
ICT	Isocitric acid	C6 H8 O7	1

Primary citation

Crystal structures of aconitase with isocitrate and nitroisocitrate bound. Lauble, H., Kennedy, M.C., Beinert, H. et al. Biochemistry (1992) 31:2735-2748. DOI 10.1021/bi00125a014 · PubMed

Other PDB entries of the same protein (UniProt P16276 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ACN 2.1 Å, Structure of activated aconitase. Formation of the (4FE-4S) cluster in the crystal
1B0J 2.5 Å, Crystal structure of aconitase with isocitrate
1B0K 2.5 Å, S642A:FLUOROCITRATE complex of aconitase
1B0M 2.5 Å, Aconitase R644Q:FLUOROCITRATE complex
6ACN 2.5 Å, Structure of activated aconitase. Formation of the (4FE-4S) cluster in the crystal

Browse more

7ACN is part of these collections:

Metabolism and cellular energy

About this viewer

MolViewer shows 7ACN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.