Structure of the W64R amyloidogenic variant of human lysozyme. Determined by X-ray diffraction at 1.15 Å resolution. Released 25 Aug 2021.
Explore 7AP7 in 3D Show helices and sheets RCSB PDB PDBe
7AP7 contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| α-helix | 5-14 | 10 | |
| β-strand | 20 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| α-helix | 25-36 | 12 | |
| β-strand | 39 | 1 | 1 |
| β-strand | 43-46 | 4 | 3 |
| β-strand | 51-54 | 4 | 3 |
| β-strand | 59-60 | 2 | 3 |
| β-strand | 66 | 1 | 4 |
| β-strand | 80 | 1 | 4 |
| α-helix | 81-85 | 5 | |
| α-helix | 90-101 | 12 | |
| α-helix | 105-108 | 4 | |
| α-helix | 110-115 | 6 | |
| α-helix | 122-124 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysozyme C | A | protein | 130 | Homo sapiens | P61626 (AlphaFold model) |
>7AP7_1 Lysozyme C (chains A) KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQIN SRYRCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD VRQYVQGCGV
Characterisation of the structural, dynamic and aggregation properties of the W64R amyloidogenic variant of human lysozyme. Vettore, N., Moray, J., Brans, A. et al. Biophys Chem (2021) 271:106563-106563. DOI 10.1016/j.bpc.2021.106563 · PubMed
Other PDB entries of the same protein (UniProt P61626 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7AP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.