7ARX: Catalytic fragment of masp-1

Crystal structure of the catalytic fragment of masp-1 in complex with SFMI1. Determined by X-ray diffraction at 2.42 Å resolution. Released 3 Nov 2021.

Method: X-ray diffraction
Resolution: 2.42 Å
Organisms: Homo sapiens, Helianthus annuus
Chains: 3
Atoms: 2,977
Mol. weight: 47.11 kDa
Released: 3 Nov 2021

Explore 7ARX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ARX contains 15 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	300-301	2	1
α-helix	302-304	3
α-helix	306-307	2
β-strand	310-313	4	2
β-strand	319-320	2	1
β-strand	324-329	6	2
β-strand	333-336	4	3
β-strand	341-342	2	3
β-strand	345-348	4	2
β-strand	349	1	4
β-strand	355	1	4
β-strand	361-364	4	3
α-helix	365	1
β-strand	366	1	5
α-helix	370-373	4
β-strand	376-380	5	6
β-strand	388	1	5
β-strand	392-397	6	6
β-strand	402-404	3	7
β-strand	411-414	4	6
β-strand	420-421	2	6
β-strand	422	1	8
β-strand	426	1	8
α-helix	429-430	2
β-strand	432-434	3	7

Chain B: 10 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	450	1	9
β-strand	453-454	2	10
α-helix	455-456	2
β-strand	463-468	6	11
β-strand	473-480	8	11
β-strand	484-487	4	11
α-helix	489-492	4
β-strand	493	1	12
α-helix	494-496	3
α-helix	505-507	3
β-strand	508	1	12
α-helix	509-510	2
α-helix	511-513	3
β-strand	514-518	5	11
β-strand	522	1	13
β-strand	531-533	3	11
β-strand	535-540	6	11
β-strand	545	1	14
β-strand	550	1	14
β-strand	554-558	5	11
β-strand	565	1	15
β-strand	568	1	15
β-strand	572	1	10
α-helix	573-574	2
β-strand	583-588	6	10
β-strand	600	1	13
β-strand	602-608	7	10
α-helix	609-610	2
α-helix	611-617	7
β-strand	629-632	4	10
β-strand	640	1	9
β-strand	649-654	6	10
β-strand	659-670	12	10
β-strand	679-683	5	10
α-helix	688-695	8

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-4	3	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mannan-binding lectin serine protease 1	A	protein	155	Homo sapiens	P48740 (AlphaFold model)
Mannan-binding lectin serine protease 1	B	protein	251	Homo sapiens	P48740 (AlphaFold model)
SFMI1 - Sunflower MASP1 inhibitor	C	protein	14	Helianthus annuus	Q4GWU5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ARX_1 Mannan-binding lectin serine protease 1 (chains A)
ASMTGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDG
TWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYT
CSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMAR

Sequence of entity 2 (B), FASTA

>7ARX_2 Mannan-binding lectin serine protease 1 (chains B)
IFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDL
LSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFV
MPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRD
MICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNK
DWIQRVTGVRN

Sequence of entity 3 (C), FASTA

>7ARX_3 SFMI1 - Sunflower MASP1 inhibitor (chains C)
GICSRSLPPICIPD

Primary citation

Directed Evolution-Driven Increase of Structural Plasticity Is a Prerequisite for Binding the Complement Lectin Pathway Blocking MASP-Inhibitor Peptides. Durvanger, Z., Boros, E., Nagy, Z.A. et al. ACS Chem Biol (2022) 17:969-986. DOI 10.1021/acschembio.2c00114 · PubMed

Other PDB entries of the same protein (UniProt P48740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEM 2.3 Å, CUB1-EGF-CUB2 domain of HUMAN MASP-1/3
4IGD 2.5 Å, Crystal structure of the zymogen catalytic region of Human MASP-1
3GOV 2.55 Å, Crystal structure of the catalytic region of human MASP-1
4KKD 2.6 Å, The X-ray crystal structure of Mannose-binding lectin-associated serine proteinase-3…
4DJZ 3.2 Å, Catalytic fragment of masp-1 in complex with its specific inhibitor developed by…
4IW4 3.2 Å, Crystal structure of the serine protease domain of MASP-3 in complex with ecotin
7PQO 3.39 Å, Catalytic fragment of MASP-1 in complex with P1 site mutant ecotin
4AQB 4.2 Å, MBL-Ficolin Associated Protein-1, MAP-1 aka MAP44

Browse structure collections

About this viewer

MolViewer shows 7ARX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.