7B0Y: Transcribing RNA polymerase II-U1 snRNP complex

Structure of a transcribing RNA polymerase II-U1 snRNP complex. Determined by electron microscopy at 3.6 Å resolution. Released 13 Jan 2021.

Method: Electron microscopy
Resolution: 3.6 Å
Organisms: Sus scrofa domesticus, synthetic construct, Homo sapiens
Chains: 25
Atoms: 43,792
Mol. weight: 823.57 kDa
Ligands: MG, ZN
Released: 13 Jan 2021

Explore 7B0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B0Y contains 202 α-helices and 304 β-strands across 21 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 80 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	43	1	4
β-strand	47-48	2	5
β-strand	51-52	2	5
α-helix	53	1
β-strand	56	1	4
α-helix	60-62	3
α-helix	82-85	4
β-strand	88-94	7	6
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	7
β-strand	117	1	7
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	8
β-strand	187	1	8
β-strand	190-194	5	9
β-strand	197-201	5	9
β-strand	213-216	4	9
α-helix	218-227	10
α-helix	230-235	6
α-helix	246-248	3
β-strand	250-253	4	6
α-helix	254-256	3
β-strand	265	1	10
β-strand	271	1	10
α-helix	272-274	3
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-327	2
β-strand	329	1	11
α-helix	331-333	3
α-helix	334	1
β-strand	335	1	11
α-helix	336	1
α-helix	339-342	4
α-helix	350-354	5
β-strand	357-359	3	12
β-strand	362-369	8	13
β-strand	377-381	5	13
α-helix	382-387	6
β-strand	389-393	5	14
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	14
β-strand	426-428	3	14
β-strand	445-449	5	14
α-helix	450	1
β-strand	455-459	5	13
α-helix	466-468	3
β-strand	469-477	9	13
β-strand	482-484	3	13
α-helix	487-489	3
β-strand	500-504	5	13
α-helix	509-518	10
β-strand	520	1	13
α-helix	522-524	3
β-strand	526-527	2	15
β-strand	532-533	2	15
α-helix	539-548	10
β-strand	554-555	2	16
α-helix	557-564	8
α-helix	574	1
β-strand	575	1	17
α-helix	576-577	2
β-strand	579-581	3	18
β-strand	585	1	18
β-strand	586-587	2	16
α-helix	588-595	8
β-strand	602-603	2	19
β-strand	629-631	3	19
β-strand	634-637	4	19
α-helix	642-645	4
α-helix	652-659	8
α-helix	662-683	22
β-strand	686	1	20
α-helix	689-692	4
α-helix	696-721	26
α-helix	727-728	2
α-helix	733-759	27
α-helix	765-772	8
α-helix	778-785	8
β-strand	789-790	2	21
β-strand	793	1	22
β-strand	796	1	22
α-helix	798-799	2
β-strand	802	1	23
β-strand	805	1	23
β-strand	822-823	2	21
α-helix	833-867	35
β-strand	872-873	2	24
β-strand	879-880	2	24
β-strand	886-888	3	24
α-helix	891-893	3
β-strand	896	1	25
β-strand	902-905	4	26
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	27
α-helix	936-944	9
α-helix	947-969	23
β-strand	976-979	4	26
α-helix	983-993	11
α-helix	1001	1
β-strand	1002	1	27
α-helix	1006-1019	14
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1053-1056	4
α-helix	1062-1079	18
β-strand	1080	1	25
α-helix	1081-1082	2
α-helix	1087-1096	10
α-helix	1098-1100	3
α-helix	1121-1128	8
β-strand	1139-1140	2	28
β-strand	1141-1142	2	29
β-strand	1143	1	30
α-helix	1146-1149	4
α-helix	1151-1161	11
β-strand	1162	1	31
β-strand	1164-1165	2	32
α-helix	1166-1169	4
β-strand	1170-1177	8	33
α-helix	1190-1197	8
β-strand	1210-1216	7	33
α-helix	1218-1222	5
α-helix	1228-1238	11
α-helix	1240-1242	3
β-strand	1243-1245	3	33
β-strand	1256-1261	6	33
α-helix	1281-1295	15
β-strand	1297-1299	3	32
β-strand	1301	1	31
β-strand	1307-1310	4	29
β-strand	1319-1322	4	34
β-strand	1328-1331	4	34
β-strand	1335-1338	4	29
α-helix	1343-1346	4
β-strand	1352	1	30
β-strand	1358-1359	2	28
α-helix	1362-1368	7
α-helix	1371-1387	17
α-helix	1395-1404	10
β-strand	1408	1	35
α-helix	1416-1419	4
α-helix	1426-1430	5
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1467-1469	3
β-strand	1471-1475	5	36

Chain b: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	53-55	3
α-helix	65-88	24
β-strand	104-108	5	86
α-helix	116-123	8
β-strand	129-136	8	86
β-strand	143-151	9	86
α-helix	154-164	11
β-strand	168-169	2	87
β-strand	172-173	2	87
β-strand	175-177	3	86
α-helix	190-192	3

Chain B: 51 helices, 86 β-strands

Element	Residues	Length	Sheet
α-helix	16-18	3
α-helix	19-36	18
α-helix	41-49	9
α-helix	50-54	5
α-helix	55-61	7
α-helix	63-64	2
β-strand	67-68	2	37
β-strand	83-84	2	37
β-strand	87-93	7	38
β-strand	97-99	3	39
β-strand	105-107	3	39
α-helix	110-116	7
β-strand	119	1	40
β-strand	121-132	12	38
β-strand	133	1	37
β-strand	140-153	14	38
α-helix	168-173	6
β-strand	185-187	3	40
β-strand	190-193	4	40
α-helix	194-195	2
β-strand	196-200	5	41
β-strand	206-208	3	42
β-strand	215-223	9	42
β-strand	233-238	6	42
β-strand	239	1	43
β-strand	240	1	42
α-helix	254-255	2
β-strand	256	1	43
β-strand	257-258	2	44
β-strand	259	1	42
β-strand	267-268	2	44
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-324	11
α-helix	332-341	10
α-helix	342-346	5
α-helix	349-351	3
α-helix	358-376	19
α-helix	381-384	4
α-helix	388-390	3
β-strand	391-394	4	41
α-helix	396-423	28
α-helix	431-434	4
α-helix	438-450	13
β-strand	468-469	2	40
α-helix	470-471	2
α-helix	475-482	8
β-strand	484	1	45
β-strand	485-486	2	41
α-helix	496-499	4
α-helix	503-505	3
β-strand	509	1	46
β-strand	525	1	45
β-strand	526	1	46
β-strand	531-532	2	47
α-helix	539-547	9
β-strand	551-552	2	48
α-helix	558-561	4
β-strand	565-569	5	48
β-strand	572-577	6	48
α-helix	580-592	13
β-strand	602-605	4	48
β-strand	612-615	4	48
β-strand	621-627	7	47
β-strand	628	1	49
β-strand	633	1	49
α-helix	637-644	8
α-helix	653-658	6
β-strand	662-666	5	47
α-helix	667-670	4
α-helix	679-682	4
β-strand	695-696	2	47
α-helix	700-703	4
α-helix	714-716	3
β-strand	717	1	50
α-helix	719-728	10
β-strand	732	1	51
β-strand	734	1	52
β-strand	747-751	5	52
β-strand	755	1	53
β-strand	759-760	2	54
α-helix	764-767	4
β-strand	776-782	7	55
β-strand	783	1	20
β-strand	793-797	5	55
α-helix	798-802	5
β-strand	808-817	10	52
β-strand	822	1	56
β-strand	825	1	56
β-strand	827-829	3	57
β-strand	848	1	58
β-strand	853	1	59
β-strand	854	1	58
α-helix	855	1
β-strand	859-860	2	52
β-strand	865-867	3	59
β-strand	869-872	4	57
β-strand	889-891	3	57
β-strand	894-895	2	59
α-helix	896-897	2
β-strand	902-911	10	52
β-strand	917-927	11	52
β-strand	934-937	4	55
β-strand	942-949	8	55
β-strand	956	1	60
β-strand	965-967	3	55
α-helix	971-975	5
β-strand	977	1	50
α-helix	978-993	16
β-strand	997-998	2	54
α-helix	1008-1016	9
β-strand	1025-1026	2	55
β-strand	1029	1	60
α-helix	1035	1
β-strand	1036	1	60
α-helix	1037	1
β-strand	1041-1050	10	55
β-strand	1051	1	51
β-strand	1060-1062	3	13
β-strand	1067	1	61
β-strand	1074	1	61
α-helix	1082-1083	2
β-strand	1084-1086	3	12
α-helix	1088-1097	10
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
β-strand	1127-1129	3	62
β-strand	1134-1136	3	62
β-strand	1137	1	63
β-strand	1142	1	63
β-strand	1146-1150	5	1
α-helix	1153-1163	11
β-strand	1167	1	3
β-strand	1170-1172	3	2

Chain c: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	88
α-helix	23-34	12
α-helix	35-37	3
β-strand	40-46	7	88
β-strand	54-59	6	88
α-helix	62-72	11
β-strand	76	1	89
β-strand	81	1	89
β-strand	83-86	4	88
α-helix	92-98	7

Chain C: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	64
β-strand	13-14	2	64
β-strand	18-24	7	64
α-helix	28-40	13
β-strand	44-49	6	65
β-strand	50-51	2	66
β-strand	52-55	4	67
α-helix	61-69	9
β-strand	73	1	68
β-strand	99-100	2	65
β-strand	101-102	2	69
β-strand	103-106	4	67
α-helix	112	1
β-strand	113-116	4	70
α-helix	117-119	3
β-strand	121-122	2	69
β-strand	129	1	68
β-strand	149-153	5	70
β-strand	158-161	4	67
β-strand	164-168	5	65
α-helix	174-176	3
β-strand	179-182	4	64
β-strand	185	1	64
α-helix	200-202	3
α-helix	218-220	3
β-strand	229-235	7	64
α-helix	241-267	27

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	71
β-strand	21	1	71
α-helix	24-26	3
β-strand	30-31	2	72
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	78-89	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-136	13

Chain e: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8
α-helix	30-38	9
β-strand	42-46	5	90
β-strand	51-56	6	90
β-strand	66-76	11	90
β-strand	90-101	12	90
β-strand	106-111	6	90

Chain E: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	4-24	21
β-strand	26-27	2	73
α-helix	30-33	4
α-helix	37-43	7
β-strand	47	1	74
β-strand	52	1	74
β-strand	60-64	5	73
β-strand	71-75	5	73
β-strand	81-82	2	75
α-helix	84-97	14
β-strand	101-106	6	73
β-strand	109-110	2	75
α-helix	112-120	9
β-strand	126-131	6	73
α-helix	132-135	4
α-helix	139-141	3
β-strand	147-150	4	35
α-helix	151-152	2
α-helix	153-163	11
α-helix	167-169	3
β-strand	172-173	2	35
α-helix	178-183	6
β-strand	190-197	8	35
β-strand	201-209	9	35

13 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Sus scrofa domesticus	P11414 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa domesticus	A0A0B8RVL1 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa domesticus	I3LCH3 (AlphaFold model)
DNA-directed RNA polymerase II subunit D	D	protein	142	Sus scrofa domesticus	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa domesticus	I3LSI7
DNA-directed RNA polymerase II subunit F	F	protein	127	Sus scrofa domesticus	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa domesticus	I3LJZ9
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa domesticus	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa domesticus	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa domesticus	A0A4X1VYD0
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa domesticus	F1RKE4
RPB12	L	protein	58	Sus scrofa domesticus	A0A4X1TRS6

13 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>7B0Y_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>7B0Y_2 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>7B0Y_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>7B0Y_4 DNA-directed RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY

Sequence of entity 5 (E), FASTA

>7B0Y_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>7B0Y_6 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>7B0Y_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>7B0Y_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>7B0Y_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>7B0Y_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>7B0Y_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>7B0Y_12 RPB12 (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	8

Primary citation

Structure of a transcribing RNA polymerase II-U1 snRNP complex. Zhang, S., Aibara, S., Vos, S.M. et al. Science (2021) 371:305-309. DOI 10.1126/science.abf1870 · PubMed

Other PDB entries of the same protein (UniProt P11414 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
7OPD 3.0 Å, Pol II-CSB-CRL4CSA-UVSSA-SPT6-PAF (Structure 5)
8OEU 3.04 Å, Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
8OF0 3.05 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, Structure 1
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8P4F 4.0 Å, Structural insights into human co-transcriptional capping - structure 6

Browse structure collections

About this viewer

MolViewer shows 7B0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.