7B26: CirpA1

CirpA1 in complex with pseudo-monomeric Properdin lacking TSR2-3. Determined by X-ray diffraction at 3.4 Å resolution. Released 8 Dec 2021.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Homo sapiens, Rhipicephalus pulchellus
Chains: 3
Atoms: 3,684
Mol. weight: 64.35 kDa
Ligands: MAN
Released: 8 Dec 2021

Explore 7B26 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B26 contains 14 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	30-37	8	10
β-strand	42-51	10	10
α-helix	53-56	4
β-strand	63-65	3	10
β-strand	72-74	3	10
α-helix	77-78	2
β-strand	79-80	2	11
α-helix	81-88	8
β-strand	95-103	9	8
β-strand	104-105	2	11
β-strand	111	1	12
β-strand	115	1	12
β-strand	120-128	9	8

Chain B: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	265-269	5
β-strand	275-281	7	1
β-strand	301-307	7	1
α-helix	311-313	3
β-strand	314	1	2
β-strand	317-318	2	3
α-helix	323-326	4
β-strand	328	1	4
β-strand	329	1	5
β-strand	332	1	5
β-strand	342-347	6	4
β-strand	350-351	2	3
β-strand	354	1	2
α-helix	357-360	4
β-strand	365-372	8	4
β-strand	377-379	3	6
β-strand	380-382	3	7
α-helix	383-388	6
β-strand	391-392	2	8
β-strand	400-406	7	8
β-strand	407-409	3	7
β-strand	429-432	4	4
β-strand	436-438	3	6
β-strand	442	1	9
β-strand	445	1	9
β-strand	448-454	7	8
α-helix	458-460	3

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	52-55	4
β-strand	60-66	7	13
α-helix	71-72	2
β-strand	73-82	10	13
β-strand	86-95	10	13
β-strand	98-109	12	13
β-strand	120-123	4	13
β-strand	130-138	9	13
β-strand	144-152	9	13
β-strand	157-165	9	13
α-helix	174-176	3
α-helix	177-190	14
α-helix	192-194	3
β-strand	195	1	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Properdin	B	protein	247	Homo sapiens	P27918 (AlphaFold model)
Properdin	A	protein	134	Homo sapiens	P27918 (AlphaFold model)
CirpA1	C	protein	180	Rhipicephalus pulchellus	A0A8X6EGU0 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7B26_1 Properdin (chains B)
MITEGAQAPRLLLPPLLLLLTLPATGSVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPV
PQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGR
TCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCT
PLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
LHHHHHH

Sequence of entity 2 (A), FASTA

>7B26_2 Properdin (chains A)
MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNT
AFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTL
EWQLQACEDQQACP

Sequence of entity 3 (C), FASTA

>7B26_3 CirpA1 (chains C)
GPMGEDQETDFSSTDGAELIAKEPEVYPIDQFMNNTEIWVFNTTQPDPPNCKKDKSKSMT
QTATSFVRSHVKNGNIIEENLVGNFTYFNDKEKVYDGIYISGESSGVYAEHLYYVSEDKK
CGLFQVFAHVNDKTTIWRDVRVSGRPEEGVPLELNCTKEFDEYVKLVNATSKSPYTSECQ

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	9

Primary citation

Structure and function of a family of tick-derived complement inhibitors targeting properdin. Braunger, K., Ahn, J., Jore, M.M. et al. Nat Commun (2022) 13:317-317. DOI 10.1038/s41467-021-27920-2 · PubMed

Other PDB entries of the same protein (UniProt P27918 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6R 1.9 Å, Structure of complement FP in complex with the TPP-3077 VHH
6S08 2.03 Å, Crystal Structure of Properdin (TSR domains N1 & 456)
6S0B 2.31 Å, Crystal Structure of Properdin in complex with the CTC domain of C3/C3b
6S0A 2.52 Å, Crystal Structure of Properdin (TSR domains N12 & 456)
9U62 2.7 Å, AP pathways C3 convertase C3bBbP and C3 complex
6RUS 2.8 Å, Structure of a functional properdin monomer
6SEJ 3.5 Å, Structure of a functional monomeric properdin lacking TSR3
6RV6 3.51 Å, Structure of properdin lacking TSR3 based on anomalous data
7NOZ 3.9 Å, Structure of the nanobody stablized properdin bound alternative pathway proconvertase…
6RUR 6.0 Å, Structure of the SCIN stabilized C3bBb convertase bound to properdin
6RUV 6.15 Å, Structure of the SCIN stabilized C3bBb convertase bound to Properdin and a the…
1W0R Solution structure of dimeric form of properdin by X-ray solution scattering and…

Browse structure collections

About this viewer

MolViewer shows 7B26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.