7BJS: Khc/atypical Tm1 complex

Crystal structure of Khc/atypical Tm1 complex. Determined by X-ray diffraction at 2.28 Å resolution. Released 26 May 2021.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Drosophila melanogaster
Chains: 3
Atoms: 1,596
Mol. weight: 30.93 kDa
Released: 26 May 2021

Explore 7BJS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BJS contains 5 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	856-921	66

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	857-914	58

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	260-273	14
α-helix	274-279	6
α-helix	280-323	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin heavy chain	A, B	protein	89	Drosophila melanogaster	P17210 (AlphaFold model)
SD21996p	C	protein	85	Drosophila melanogaster	Q8IGY1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7BJS_1 Kinesin heavy chain (chains A, B)
SMSFLENNLDQLTKVHKQLVRDNADLRCELPKLEKRLRCTMERVKALETALKEAKEGAMR
DRKRYQYEVDRIKEAVRQKHLGRRGPQAQ

Sequence of entity 2 (C), FASTA

>7BJS_2 SD21996p (chains C)
SMGRSIFSSDTMMKFNIIRNELHNIMNTQLKRAESEVAALNRRIQLLEEDLERSEERLGS
ATAKLSEASQAADESERARKILENR

Primary citation

Molecular basis of mRNA transport by a kinesin-1-atypical tropomyosin complex. Dimitrova-Paternoga, L., Jagtap, P.K.A., Cyrklaff, A. et al. Genes Dev (2021) 35:976-991. DOI 10.1101/gad.348443.121 · PubMed

Other PDB entries of the same protein (UniProt P17210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JVU 1.95 Å, The neck-linker and alpha 7 helix of Drosophila melanogaster kinesin-1 fused to EB1
5JVR 2.1 Å, The neck-linker of Mus musculus KIF3A fused to the alpha 7 helix of Drosophila…
2Y65 2.2 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer-tail complex
5JVS 2.25 Å, The neck-linker + DAL and alpha 7 helix of Drosophila melanogaster Kinesin-1 fused to EB1
2Y5W 2.7 Å, Crystal structure of Drosophila melanogaster kinesin-1 motor domain dimer

Browse structure collections

About this viewer

MolViewer shows 7BJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.