7BRQ: Human FAM134B LIR fused to human GABARAP

Crystal structure of human FAM134B LIR fused to human GABARAP. Determined by X-ray diffraction at 1.4 Å resolution. Released 8 Jul 2020.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,217
Mol. weight: 16.21 kDa
Released: 8 Jul 2020

Explore 7BRQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BRQ contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
α-helix	14-18	5
α-helix	20-23	4
α-helix	25-29	5
α-helix	32-45	14
β-strand	49-56	8	1
β-strand	69-73	5	1
β-strand	77	1	2
α-helix	78-86	9
β-strand	98-100	3	1
β-strand	101	1	3
β-strand	104	1	3
α-helix	105-107	3
β-strand	111	1	2
α-helix	112-119	8
α-helix	125	1
β-strand	126-131	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Reticulophagy regulator 1,Gamma-aminobutyric acid receptor-associated protein	A	protein	137	Homo sapiens	O95166 (AlphaFold model), Q9H6L5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BRQ_1 Reticulophagy regulator 1,Gamma-aminobutyric acid receptor-associated protein (chains A)
GPEEGDDFELLDQSELDQIESMKSTYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKA
RIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH
EEDFFLYIAYSDESVYG

Primary citation

Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes. Mochida, K., Yamasaki, A., Matoba, K. et al. Nat Commun (2020) 11:3306-3306. DOI 10.1038/s41467-020-17163-y · PubMed

Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HYO 1.07 Å, Structure of ULK1 LIR motif bound to GABARAP
6YOP 1.1 Å, Structure of SAMM50 LIR bound to GABARAP
7ZKR 1.1 Å, Human GABARAP in complex with stapled peptide Pen3-ortho
6HYN 1.14 Å, Structure of ATG13 LIR motif bound to GABARAP
7AA8 1.25 Å, Structure of SCOC LIR bound to GABARAP
6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
8T2M 1.27 Å, Crystal structure of GABARAP in complex with the LIR of NSs4
3D32 1.3 Å, Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
6HB9 1.3 Å, Crystal structure of the GABARAP in complex with the UBA5 LIR motif
9I9X 1.42 Å, Human GABARAP in complex with artificial peptide IM-2
9HGD 1.5 Å, Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23
6HOJ 1.51 Å, Structure of Beclin1 LIR motif bound to GABARAP

Browse structure collections

About this viewer

MolViewer shows 7BRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.