7BXF: MvcA-Lpg2149 complex

MvcA-Lpg2149 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 May 2020.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Chains: 2
Atoms: 3,881
Mol. weight: 59.11 kDa
Ligands: PR
Released: 20 May 2020

Explore 7BXF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BXF contains 25 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	32-36	5
α-helix	40-51	12
α-helix	61-73	13
α-helix	83-105	23
α-helix	107-108	2
β-strand	109-110	2	1
α-helix	111-112	2
α-helix	116-123	8
β-strand	132-141	10	1
β-strand	146-149	4	2
α-helix	152-154	3
α-helix	161	1
β-strand	164-167	4	2
β-strand	172-175	4	2
β-strand	181-183	3	2
α-helix	188-195	8
β-strand	203-205	3	2
α-helix	218-231	14
α-helix	234-236	3
β-strand	240-250	11	1
α-helix	257-259	3
β-strand	262-264	3	1
β-strand	267	1	3
β-strand	271	1	3
α-helix	273-278	6
α-helix	281-286	6
α-helix	290-302	13
α-helix	306-316	11
β-strand	337-345	9	1
α-helix	348-362	15
α-helix	370-392	23

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	12-36	25
α-helix	44-53	10
α-helix	70-77	8
α-helix	79-82	4
α-helix	92-110	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MvcA	A	protein	401	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZTL3 (AlphaFold model)
Lpg2149	C	protein	107	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZTL2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BXF_1 MvcA (chains A)
SMIVRGINMTKIKLESPGFMVHKKLKSMSQSYGVMMTGVPAEVLGQMQAERSIPSINKTG
NLKQQIAKEVSKVCHMMTEPTQSCGQASNDVCELLLGKIEAEKFHFTKYEALSADGDNLK
NVLENTAPSSTNLLIRFEIDREDPPIVLVKTKNENFNPETAVKNKIYLLENKLYFIDKMG
NLFNLGPGKKKCTQLFNAIGDSAEYSLCDPFVLEEPEKPEDFAISEIVDIFNEQKERFDF
WIGSHSFTIYIPQTLGESPRQFYPYQAYFGSHTLQDWFVSDKDEYLSRIGIDKYIEKLAV
LGKTTNTKERSDIYAEFFSKRGREAFFCAHLNEKRQPLRVKFKITEINPELALKNLQETQ
EFIDTHPGENPSDKVENYRNRAKLAMTEHLESLLDIKPESS

Sequence of entity 2 (C), FASTA

>7BXF_2 Lpg2149 (chains C)
SGTFFKDYQKKNVMRLLQDSLEKIINEWLKTDDESHTKLKSLQELSEMDINATSFAEHSP
LPDFVTRLWLDPHKALDAMDKNISKNEIRKLIKETAREIELVFTHQK

Ligands and cofactors

ID	Name	Formula	Copies
PR	Praseodymium ion	Pr	4

Primary citation

Insights into catalysis and regulation of non-canonical ubiquitination and deubiquitination by bacterial deamidase effectors. Wang, Y., Zhan, Q., Wang, X. et al. Nat Commun (2020) 11:2751-2751. DOI 10.1038/s41467-020-16587-w · PubMed

Other PDB entries of the same protein (UniProt Q5ZTL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K11 1.94 Å, Crystal structure of MvcA from Legionella pneumophila
5SUJ 2.36 Å, Crystal structure of uncharacterized protein LPG2148 from Legionella pneumophila
6JKY 2.45 Å, Crystal structure of MvcA-UBE2N-Ub complex from Legionella pneumophila
6LP2 2.48 Å, Structure of Lpg2148/UBE2N-Ub complex
5YM9 2.5 Å, Crystal Structure of the Deamidase from Legionella pneumophila
6LW4 2.7 Å, Structure of Lpg2148/Lpg2149 complex

Browse structure collections

About this viewer

MolViewer shows 7BXF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.