crystal structure of Arabidopsis AIPP3 BAH domain in complex with an H3K27me3 peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 16 Dec 2020.
Explore 7CCE in 3D Show helices and sheets RCSB PDB PDBe
7CCE contains 7 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 120-121 | 2 | 1 |
| β-strand | 124-126 | 3 | 2 |
| β-strand | 129-131 | 3 | 2 |
| β-strand | 136-139 | 4 | 1 |
| β-strand | 141 | 1 | 3 |
| α-helix | 147-148 | 2 | |
| β-strand | 149-158 | 10 | 1 |
| β-strand | 164-172 | 9 | 1 |
| β-strand | 178 | 1 | 4 |
| α-helix | 179 | 1 | |
| β-strand | 184 | 1 | 4 |
| β-strand | 192-203 | 12 | 1 |
| α-helix | 204-206 | 3 | |
| β-strand | 207-210 | 4 | 1 |
| β-strand | 213-215 | 3 | 1 |
| β-strand | 220 | 1 | 5 |
| α-helix | 221-224 | 4 | |
| β-strand | 231-238 | 8 | 1 |
| β-strand | 243-245 | 3 | 1 |
| α-helix | 254-270 | 17 | |
| β-strand | 276 | 1 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-24 | 2 | |
| β-strand | 25 | 1 | 3 |
| α-helix | 26-28 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromo-adjacent homology (BAH) domain-containing protein | A | protein | 169 | Arabidopsis thaliana | Q8RXT5 (AlphaFold model) |
| Histone H3.2 | P | protein | 18 | Arabidopsis thaliana | P59226 (AlphaFold model) |
>7CCE_1 Bromo-adjacent homology (BAH) domain-containing protein (chains A) SGKGKGKRTHFNQFAYDGNTYDLEVPVLLVPEDKSQKPYVAIIKDITQTKDGSMMILGQW FYRPEEAEKRGGGNWQSSDTRELFYSFHRDEVPAESVMHRCVVYFVPAHKQLPKRKNNPG FIVRKVYDTVEKKLWKLTDKDYEDSKQREIDVLVKKTMNVLGDLPDLES
>7CCE_2 Histone H3.2 (chains P) LATKAARKSAPATGGVKK
Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis. Zhang, Y.Z., Yuan, J., Zhang, L. et al. Nat Commun (2020) 11:6212-6212. DOI 10.1038/s41467-020-20089-0 · PubMed
MolViewer shows 7CCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.