7CCS: Consensus mutated xCT-CD98hc complex

Consensus mutated xCT-CD98hc complex. Determined by electron microscopy at 6.2 Å resolution. Released 9 Dec 2020.

Method: Electron microscopy
Resolution: 6.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,177
Mol. weight: 124 kDa
Released: 9 Dec 2020

Explore 7CCS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CCS contains 49 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	168-171	4
α-helix	177-206	30
β-strand	225-227	3	1
α-helix	231-235	5
α-helix	242-255	14
β-strand	259-262	4	1
β-strand	266	1	2
β-strand	281	1	2
α-helix	288-300	13
β-strand	304-307	4	1
α-helix	325-341	17
β-strand	345-348	4	3
α-helix	351-353	3
α-helix	357-371	15
β-strand	376-381	6	3
α-helix	386-395	10
β-strand	400-403	4	3
α-helix	404-407	4
α-helix	413-427	15
β-strand	433-434	2	4
α-helix	442-445	4
α-helix	448-459	12
β-strand	464-465	2	4
β-strand	466-468	3	1
α-helix	471-473	3
α-helix	477-479	3
α-helix	510-515	6
α-helix	520-533	14
α-helix	535-538	4
β-strand	540-544	5	5
β-strand	547	1	6
β-strand	551-558	8	5
β-strand	563-569	7	5
β-strand	576	1	7
β-strand	579	1	6
α-helix	581-583	3
α-helix	586-588	3
β-strand	593-598	6	5
β-strand	609-611	3	5
α-helix	612-614	3
β-strand	616	1	7
β-strand	621-627	7	5

Chain B: 28 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	46-54	9
α-helix	65-70	6
β-strand	76	1	8
α-helix	77-103	27
α-helix	112-118	7
α-helix	122-123	2
α-helix	124-128	5
α-helix	129-132	4
α-helix	134-151	18
α-helix	152-154	3
β-strand	156	1	9
β-strand	158	1	9
α-helix	159-161	3
α-helix	164-181	18
α-helix	185-201	17
α-helix	203-215	13
α-helix	217-220	4
β-strand	225	1	8
α-helix	236-245	10
α-helix	249-258	10
α-helix	263-265	3
α-helix	266-290	25
α-helix	296-298	3
α-helix	303-309	7
α-helix	315-318	4
α-helix	322-348	27
β-strand	358-359	2	10
α-helix	366-382	17
α-helix	385-412	28
α-helix	426-445	20
α-helix	449-458	10
α-helix	461-467	7
α-helix	475-492	18
β-strand	494-495	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	631	Homo sapiens	P08195 (AlphaFold model)
Consensus mutated Anionic Amino Acid Transporter Light Chain, Xc- System	B	protein	509	Homo sapiens	Q9UPY5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CCS_1 4F2 cell-surface antigen heavy chain (chains A)
GSELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLP
SASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELE
PEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWV
RTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAG
NLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKK
KSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSF
LAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLV
TQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAAL
PGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHG
DFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLST
QPGREEGSPLELERLKLEPHEGLLLRFPYAA

Sequence of entity 2 (B), FASTA

>7CCS_2 Consensus mutated Anionic Amino Acid Transporter Light Chain, Xc- System (chains B)
MVRKPVVSTISKGGYLQGNVNGRLPSLGSKEPPGQEKVQLKREITLLDGVSLIVGTIIGA
GIFVSPKGVLKNTGSVGLSLVIWAVCGVLSLFGALCYAELGTTIPKSGGAYLYILETFGP
LPAFLRGWNELLIIRPASTAVISLAFGNYILEPFFPTCEPPELAIKLLAAVGILLLTVLN
SLSVKWSARVQDFFTAAKLLALLIIIVPGVVQLIKGQTQNFKDAFEGSDPSIGGLPLAFY
SGLYAYVGWDYLNFVTEEVKNPEKNIPLAIVISMPIVTVAYVLTNVAYFTTLSPEELLLS
NAVAVTFGERLLGNFSWAVPIFVALSCFGSLNGSLFAMSRLFYVAAREGHLPKILSMIHV
RRHTPLPALIVSGPLTAIMLFLGDLFSLINFMSFGTWLFYGLVVAGLIYLRYKKPDLHRP
IKVPLFIPILFLLTCLFLVAVSLYSDPVNCGIGFVIILTGVPVYFLFVYWDKKPKWFRRI
SEKITRHLQLLLEVVPEEDKLDYKDDDDK

Primary citation

Consensus mutagenesis approach improves the thermal stability of system x c - transporter, xCT, and enables cryo-EM analyses. Oda, K., Lee, Y., Wiriyasermkul, P. et al. Protein Sci (2020) 29:2398-2407. DOI 10.1002/pro.3966 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 7CCS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.