Crystal Structure of SETDB1 tudor domain in complexed with Compound 6. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Apr 2021.
Explore 7CD9 in 3D Show helices and sheets RCSB PDB PDBe
7CD9 contains 13 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 192 | 1 | 1 |
| β-strand | 194-195 | 2 | 2 |
| β-strand | 198-199 | 2 | 2 |
| β-strand | 203-207 | 5 | 1 |
| β-strand | 212 | 1 | 3 |
| β-strand | 213-224 | 12 | 1 |
| β-strand | 227-234 | 8 | 1 |
| β-strand | 239-242 | 4 | 1 |
| α-helix | 244-246 | 3 | |
| β-strand | 247-249 | 3 | 1 |
| α-helix | 252-254 | 3 | |
| β-strand | 263-270 | 8 | 3 |
| β-strand | 273-283 | 11 | 3 |
| β-strand | 293-297 | 5 | 3 |
| β-strand | 302-305 | 4 | 3 |
| α-helix | 307-309 | 3 | |
| β-strand | 310-312 | 3 | 3 |
| β-strand | 313 | 1 | 1 |
| α-helix | 320-323 | 4 | |
| α-helix | 327-339 | 13 | |
| β-strand | 353-358 | 6 | 4 |
| β-strand | 361-371 | 11 | 4 |
| β-strand | 374-379 | 6 | 4 |
| β-strand | 385-389 | 5 | 4 |
| β-strand | 395 | 1 | 4 |
| α-helix | 396-404 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 194-195 | 2 | 5 |
| β-strand | 198-199 | 2 | 5 |
| β-strand | 203-207 | 5 | 6 |
| β-strand | 212 | 1 | 7 |
| β-strand | 213-224 | 12 | 6 |
| β-strand | 227-234 | 8 | 6 |
| β-strand | 239-243 | 5 | 6 |
| α-helix | 244-246 | 3 | |
| β-strand | 247-249 | 3 | 6 |
| α-helix | 252-254 | 3 | |
| α-helix | 255-257 | 3 | |
| β-strand | 263-269 | 7 | 7 |
| β-strand | 274-283 | 10 | 7 |
| β-strand | 293-297 | 5 | 7 |
| β-strand | 302-305 | 4 | 7 |
| α-helix | 307-309 | 3 | |
| β-strand | 310-312 | 3 | 7 |
| β-strand | 313 | 1 | 6 |
| α-helix | 320-323 | 4 | |
| α-helix | 327-339 | 13 | |
| β-strand | 353-358 | 6 | 8 |
| β-strand | 361-371 | 11 | 8 |
| β-strand | 374-379 | 6 | 8 |
| β-strand | 385-389 | 5 | 8 |
| β-strand | 395 | 1 | 8 |
| α-helix | 396-403 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase SETDB1 | A, B | protein | 240 | Homo sapiens | Q15047 (AlphaFold model) |
>7CD9_1 Histone-lysine N-methyltransferase SETDB1 (chains A, B) GSSHHHHHHSSGENLYFQGGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKY KVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNK LRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS GQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALE
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 2 |
| FVR | 3-methyl-2-[[(3R,5R)-1-methyl-5-(4-phenylmethoxyphenyl)piperidin-3-yl]amino]-5H… | C26 H29 N5 O2 | 2 |
Structure-Guided Discovery of a Potent and Selective Cell-Active Inhibitor of SETDB1 Tudor Domain. Guo, Y., Mao, X., Xiong, L. et al. Angew Chem Int Ed Engl (2021) 60:8760-8765. DOI 10.1002/anie.202017200 · PubMed
Other PDB entries of the same protein (UniProt Q15047 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7CD9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.