7CDB: GABARAPL1

Structure of GABARAPL1 in complex with GABA(A) receptor gamma 2. Determined by X-ray diffraction at 1.95 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,244
Mol. weight: 31.81 kDa
Ligands: CIT
Released: 2 Dec 2020

Explore 7CDB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CDB contains 14 α-helices and 17 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	4
α-helix	42-44	3
β-strand	48-52	5	4
β-strand	56	1	5
α-helix	57-68	12
β-strand	77-79	3	4
β-strand	80	1	6
β-strand	83	1	6
α-helix	84-86	3
β-strand	90	1	5
α-helix	91-98	8
β-strand	105-110	6	4

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	54-55	2	4
α-helix	58-61	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A, B	protein	123	Mus musculus	Q8R3R8 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	18	Mus musculus	P22723 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7CDB_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A, B)
GPGSEFMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSD
LTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESV
YGK

Sequence of entity 2 (C), FASTA

>7CDB_2 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
ERDEEYGYECLDGKDCAS

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	2

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structural basis of GABARAP-mediated GABA A receptor trafficking and functions on GABAergic synaptic transmission. Ye, J., Zou, G., Zhu, R. et al. Nat Commun (2021) 12:297-297. DOI 10.1038/s41467-020-20624-z · PubMed

Other PDB entries of the same protein (UniProt Q8R3R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YIP 1.85 Å, Crystal Structure of AnkG LIR/GABARAPL1 complex

Browse structure collections

About this viewer

MolViewer shows 7CDB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.