7CE0: Nucleoprotein

Crystal structure of 2019-nCoV nucleocapsid C-terminal domain (CTD) protein. Determined by X-ray diffraction at 1.5 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 4
Atoms: 4,274
Mol. weight: 53.2 kDa
Released: 2 Sept 2020

Explore 7CE0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CE0 contains 36 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and D: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	16-20	5
β-strand	32	1	1
α-helix	35-40	6
α-helix	41-43	3
α-helix	47-51	5
α-helix	55-56	2
α-helix	57-63	7
β-strand	65-71	7	2
β-strand	74-84	11	2
α-helix	92-102	11
β-strand	103	1	1
α-helix	105-108	4

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	11	1	3
β-strand	14	1	3
α-helix	16-20	5
β-strand	32	1	4
α-helix	35-40	6
α-helix	41-43	3
α-helix	47-51	5
α-helix	55-56	2
α-helix	57-63	7
β-strand	65-71	7	5
β-strand	74-84	11	5
α-helix	92-102	11
β-strand	103	1	4
α-helix	105-108	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A, B, C, D	protein	116	Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7CE0_1 Nucleoprotein (chains A, B, C, D)
HHHHHHSKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFA
PSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFP

Primary citation

Structures of the SARS-CoV-2 nucleocapsid and their perspectives for drug design. Peng, Y., Du, N., Lei, Y. et al. EMBO J (2020) 39:e105938-e105938. DOI 10.15252/embj.2020105938 · PubMed

Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LUZ 1.1 Å, GQTVTK segment from the Nucleoprotein of SARS-CoV-2, residues 243-248
7LTU 1.12 Å, Aalall segment from the nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 1
7VBF 1.3 Å, 1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization…
9F2H 1.3 Å, Crystal structure of SARS-CoV-2 N-protein C-terminal domain in complex with riluzole
7LV2 1.3 Å, GSQASS segment from the Nucleoprotein of SARS-CoV-2, residues 179-184
7LUX 1.3 Å, AALALL segment from the Nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 2
7KGQ 1.34 Å, Crystal Structure of HLA-A*0201in complex with SARS-CoV-2 N222-230
6ZCO 1.36 Å, Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from…
7KGP 1.4 Å, Crystal Structure of HLA-A*0201 in complex with SARS-CoV-2 N316-324
9IN1 1.4 Å, Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2
6WZO 1.42 Å, Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form
7N0R 1.42 Å, Structure of the SARS-CoV-2 N protein RNA-binding domain bound to single-domain antibody…

Browse structure collections

About this viewer

MolViewer shows 7CE0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.