7CEB: Alpha6beta1 integrin headpiece

Crystal structure of alpha6beta1 integrin headpiece. Determined by X-ray diffraction at 2.89 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.89 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 9,632
Mol. weight: 159.53 kDa
Ligands: MG, NAG, CA
Released: 23 Jun 2021

Explore 7CEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CEB contains 39 α-helices and 105 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 56 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	11-14	4	2
β-strand	24-30	7	3
β-strand	36-43	8	3
α-helix	46	1
β-strand	47	1	4
α-helix	48-49	2
β-strand	56	1	4
β-strand	58	1	5
β-strand	59-64	6	3
β-strand	72-73	2	3
β-strand	85-86	2	6
β-strand	92-98	7	5
β-strand	105-109	5	5
β-strand	113-116	4	6
β-strand	124-126	3	6
β-strand	130-134	5	5
β-strand	149	1	5
β-strand	171-173	3	7
β-strand	180-184	5	7
α-helix	187-190	4
β-strand	192	1	8
β-strand	193-197	5	7
β-strand	214-215	2	7
β-strand	235	1	8
β-strand	238-243	6	9
β-strand	251-257	7	9
α-helix	260-262	3
β-strand	264	1	10
β-strand	265-271	7	9
β-strand	277	1	7
β-strand	278-285	8	9
β-strand	293	1	10
β-strand	296-300	5	11
β-strand	309-314	6	11
β-strand	327-331	5	11
α-helix	341-343	3
β-strand	344-347	4	11
β-strand	357-362	6	12
β-strand	371-376	6	12
β-strand	383-390	8	12
β-strand	393-403	11	12
β-strand	409-417	9	2
β-strand	426-431	6	2
β-strand	435-439	5	2
β-strand	441	1	1
α-helix	442-443	2
β-strand	444-453	10	13
β-strand	457-458	2	14
β-strand	473-484	12	13
β-strand	493	1	15
β-strand	495	1	16
β-strand	496-501	6	17
β-strand	515-516	2	13
β-strand	525-528	4	17
β-strand	531	1	15
β-strand	538-545	8	13
α-helix	556	1
β-strand	557-562	6	17
β-strand	565	1	16
β-strand	583-584	2	13
β-strand	591-596	6	17
β-strand	597-598	2	14

Chain B: 21 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	66-71	6	18
α-helix	73-76	4
α-helix	88-90	3
β-strand	94-95	2	19
β-strand	98-103	6	18
β-strand	108-116	9	19
α-helix	117-118	2
α-helix	120-122	3
β-strand	123-130	8	20
β-strand	132	1	21
α-helix	133-135	3
α-helix	139-142	4
α-helix	145-152	8
β-strand	160-167	8	20
α-helix	180-184	5
α-helix	193-196	4
β-strand	199-206	8	20
α-helix	209-217	9
α-helix	219-221	3
β-strand	222	1	21
β-strand	229	1	22
α-helix	231-240	10
α-helix	242-245	4
β-strand	251-258	8	20
β-strand	262	1	22
α-helix	267-271	5
α-helix	276-277	2
β-strand	283-284	2	20
β-strand	287-288	2	20
α-helix	295-298	4
α-helix	299-308	10
β-strand	311-318	8	20
α-helix	322-331	10
β-strand	335-340	6	20
α-helix	347-359	13
β-strand	361-363	3	23
β-strand	364-366	3	18
α-helix	368-370	3
β-strand	373-380	8	19
α-helix	382-384	3
β-strand	386-387	2	19
β-strand	394-396	3	23
β-strand	403-412	10	19
β-strand	421-427	7	18
β-strand	434-440	7	18

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	24
β-strand	11-12	2	25
β-strand	17-25	9	24
α-helix	29-31	3
β-strand	33-39	7	26
β-strand	45-51	7	26
β-strand	57-58	2	26
α-helix	61-63	3
β-strand	64	1	27
β-strand	67	1	27
β-strand	68-72	5	24
β-strand	77-82A	7	24
α-helix	84-86	3
β-strand	88-95	8	26
β-strand	100C-103	4	26
β-strand	107-109	3	26
β-strand	110-111	2	25
α-helix	137-162	26

Chain D: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	28
β-strand	10-12	3	29
β-strand	19-25	7	28
α-helix	30A-32	3
β-strand	33-38	6	29
β-strand	45-49	5	29
β-strand	53-54	2	29
α-helix	55	1
β-strand	62-67	6	28
β-strand	70-75	6	28
α-helix	80-82	3
β-strand	84-90	7	29
α-helix	96	1
β-strand	97-98	2	29
β-strand	102-105	4	29
α-helix	115-117	3
α-helix	120-148	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-6	A	protein	627	Homo sapiens	P23229 (AlphaFold model)
Integrin beta-1	B	protein	454	Homo sapiens	P05556 (AlphaFold model)
TS2/16 VH(S112C)-sarah	C	protein	172	Mus musculus, Homo sapiens	Q13043 (AlphaFold model)
TS2/16 vl-SARAH(S37C)	D	protein	164	Mus musculus, Homo sapiens	Q13043 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CEB_1 Integrin alpha-6 (chains A)
FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGL
YSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNT
KQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYI
VFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGFSLD
SGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVAVV
DLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKN
IGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLD
RNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCF
EYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCM
EETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLK
EGCGDDNVCNSNLKLEYKGSLENLYFQ

Sequence of entity 2 (B), FASTA

>7CEB_2 Integrin beta-1 (chains B)
QTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDI
ENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAED
YPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTP
AKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAV
CGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIA
HLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSS
EVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDS
DSFKIRPLGFTEEVEVILQYICECEGGLENLYFQ

Sequence of entity 3 (C), FASTA

>7CEB_3 TS2/16 VH(S112C)-SARAH (chains C)
MDVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVATISSGGSYTY
YPDSVKGRFTISRDKAKNTLYLQMGSLKSEDTAMYYCTRIGYDEDYAMDHWGQGTSVTVC
SGSDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Sequence of entity 4 (D), FASTA

>7CEB_4 TS2/16 VL-SARAH(S37C) (chains D)
GSHMQIVVTQRPTTMAASPGDKIIITCSVSSIISSNYLHWYSQKPGFSPKLLIYRTSNLA
SGVPPRFSGSGSGTSYSLTIGTMEAEDVATYYCQQGSDIPLTFGDGTKLDLKRGSDYEFL
KSWTVEDLQKRLLALDPMMEQEIEEIRQKYQCKRQPILDAIEAK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6
CA	Calcium ion	Ca	4

Primary citation

Structural mechanism of laminin recognition by integrin. Arimori, T., Miyazaki, N., Mihara, E. et al. Nat Commun (2021) 12:4012-4012. DOI 10.1038/s41467-021-24184-8 · PubMed

Other PDB entries of the same protein (UniProt P23229 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CEC 3.9 Å, Structure of alpha6beta1 integrin in complex with laminin-511

Browse structure collections

About this viewer

MolViewer shows 7CEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.