Crystal structure of mouse neuroligin-3. Determined by X-ray diffraction at 2.76 Å resolution. Released 24 Feb 2021.
Explore 7CEE in 3D Show helices and sheets RCSB PDB PDBe
7CEE contains 64 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 40-43 | 4 | 1 |
| β-strand | 46-49 | 4 | 1 |
| β-strand | 51-53 | 3 | 2 |
| α-helix | 61-62 | 2 | |
| β-strand | 63-70 | 8 | 2 |
| α-helix | 77-79 | 3 | |
| α-helix | 86-89 | 4 | |
| β-strand | 93-95 | 3 | 1 |
| α-helix | 99-103 | 5 | |
| α-helix | 118-121 | 4 | |
| α-helix | 124-131 | 8 | |
| β-strand | 140-146 | 7 | 2 |
| β-strand | 177-183 | 7 | 2 |
| α-helix | 193-195 | 3 | |
| α-helix | 199-205 | 7 | |
| β-strand | 208-212 | 5 | 2 |
| α-helix | 217-221 | 5 | |
| α-helix | 233-248 | 16 | |
| α-helix | 249-252 | 4 | |
| β-strand | 254-264 | 11 | 2 |
| α-helix | 266-275 | 10 | |
| β-strand | 286-290 | 5 | 2 |
| α-helix | 304-314 | 11 | |
| α-helix | 322-331 | 10 | |
| α-helix | 334-339 | 6 | |
| α-helix | 364-370 | 7 | |
| α-helix | 372-375 | 4 | |
| β-strand | 377-383 | 7 | 2 |
| α-helix | 388-390 | 3 | |
| α-helix | 392-394 | 3 | |
| α-helix | 403-418 | 16 | |
| α-helix | 424-434 | 11 | |
| α-helix | 444-456 | 13 | |
| α-helix | 457-461 | 5 | |
| α-helix | 462-471 | 10 | |
| β-strand | 478-483 | 6 | 2 |
| α-helix | 504-507 | 4 | |
| α-helix | 510-512 | 3 | |
| α-helix | 525-544 | 20 | |
| α-helix | 571-573 | 3 | |
| β-strand | 579-583 | 5 | 2 |
| β-strand | 588-591 | 4 | 2 |
| α-helix | 595-599 | 5 | |
| α-helix | 600-604 | 5 | |
| α-helix | 605-608 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 40-43 | 4 | 3 |
| β-strand | 46-49 | 4 | 3 |
| β-strand | 51-53 | 3 | 4 |
| α-helix | 61-62 | 2 | |
| β-strand | 63-70 | 8 | 4 |
| α-helix | 77-79 | 3 | |
| α-helix | 86-89 | 4 | |
| α-helix | 93 | 1 | |
| β-strand | 94-95 | 2 | 3 |
| α-helix | 101-103 | 3 | |
| α-helix | 118-121 | 4 | |
| α-helix | 124-131 | 8 | |
| β-strand | 140-146 | 7 | 4 |
| α-helix | 176 | 1 | |
| β-strand | 177-183 | 7 | 4 |
| α-helix | 193-195 | 3 | |
| α-helix | 199-205 | 7 | |
| β-strand | 208-212 | 5 | 4 |
| α-helix | 217-221 | 5 | |
| α-helix | 233-248 | 16 | |
| α-helix | 249-252 | 4 | |
| β-strand | 254-264 | 11 | 4 |
| α-helix | 266-275 | 10 | |
| β-strand | 286-290 | 5 | 4 |
| α-helix | 304-314 | 11 | |
| α-helix | 322-331 | 10 | |
| α-helix | 334-339 | 6 | |
| α-helix | 364-370 | 7 | |
| α-helix | 372-375 | 4 | |
| β-strand | 377-383 | 7 | 4 |
| α-helix | 388-391 | 4 | |
| α-helix | 392-394 | 3 | |
| α-helix | 403-418 | 16 | |
| α-helix | 424-434 | 11 | |
| α-helix | 444-456 | 13 | |
| α-helix | 457-461 | 5 | |
| α-helix | 462-471 | 10 | |
| β-strand | 478-483 | 6 | 4 |
| α-helix | 504-507 | 4 | |
| α-helix | 510-512 | 3 | |
| α-helix | 525-544 | 20 | |
| α-helix | 571-573 | 3 | |
| β-strand | 579-583 | 5 | 4 |
| β-strand | 588-591 | 4 | 4 |
| α-helix | 595-599 | 5 | |
| α-helix | 600-604 | 5 | |
| α-helix | 605-608 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuroligin-3 | A, B | protein | 655 | Mus musculus | Q8BYM5 (AlphaFold model) |
>7CEE_1 Neuroligin-3 (chains A, B) APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRN ATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDGSGAKK QGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYR VGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLT LSHHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAK ELVEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVV DPEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALF TDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGP TDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNP RDQLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHI TRRPNGKTWSTKRPAISPAYSNENAPGSWNGDQDAGPLLVENPRDYSTEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
Canonical versus non-canonical transsynaptic signaling of neuroligin 3 tunes development of sociality in mice. Yoshida, T., Yamagata, A., Imai, A. et al. Nat Commun (2021) 12:1848-1848. DOI 10.1038/s41467-021-22059-6 · PubMed
Other PDB entries of the same protein (UniProt Q8BYM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7CEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.