7CFS: Acid-sensing ion channel 1

Cryo-EM strucutre of human acid-sensing ion channel 1a at pH 8.0. Determined by electron microscopy at 3.56 Å resolution. Released 21 Oct 2020.

Method: Electron microscopy
Resolution: 3.56 Å
Organism: Homo sapiens
Chains: 3
Atoms: 9,974
Mol. weight: 166.91 kDa
Ligands: NAG, Y01
Released: 21 Oct 2020

Explore 7CFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CFS contains 75 α-helices and 63 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 25 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	46-60	15
α-helix	68-70	3
β-strand	73-81	9	1
β-strand	85-86	2	2
α-helix	87	1
β-strand	89-94	6	3
α-helix	100-102	3
α-helix	107-110	4
α-helix	112-115	4
α-helix	134-139	6
α-helix	149-151	3
α-helix	155-161	7
α-helix	165-168	4
β-strand	169	1	1
β-strand	173-174	2	1
β-strand	177-178	2	1
α-helix	181-183	3
β-strand	185-189	5	3
β-strand	192-196	5	3
β-strand	208-209	2	2
β-strand	218	1	1
β-strand	221-223	3	1
α-helix	226-228	3
α-helix	229-231	3
β-strand	245-250	6	3
α-helix	258-261	4
β-strand	263-265	3	3
β-strand	269-280	12	1
β-strand	281	1	4
β-strand	291	1	5
α-helix	292-293	2
α-helix	311-322	12
α-helix	335-336	2
α-helix	339-341	3
α-helix	342-346	5
α-helix	347-351	5
β-strand	366	1	5
β-strand	368	1	4
β-strand	371-375	5	1
β-strand	378-380	3	1
α-helix	387-393	7
α-helix	398-404	7
β-strand	405-424	20	1
α-helix	428-442	15
α-helix	447-458	12
α-helix	459-463	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acid-sensing ion channel 1	A, B, C	protein	477	Homo sapiens	P78348 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7CFS_1 Acid-sensing ion channel 1 (chains A, B, C)
MHHHHHHHHMELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFL
GSLAVLLCVCTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHA
GELLALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLS
CHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLP
VWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCK
AVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALD
FLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIF
FEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6
Y01	Cholesterol hemisuccinate	C31 H50 O4	3

Water and common crystallization additives (NA) are not listed.

Primary citation

Structural insights into human acid-sensing ion channel 1a inhibition by snake toxin mambalgin1. Sun, D., Liu, S., Li, S. et al. Elife (2020) 9. DOI 10.7554/eLife.57096 · PubMed

Other PDB entries of the same protein (UniProt P78348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E4I 2.33 Å, Human ASIC1a at pH 7.5 in complex with MitTx
9E4H 2.61 Å, Human ASIC1a at pH 5.7 with rotated, domain-swapped transmembrane domain
9E4F 2.69 Å, Human ASIC1a at pH 5.7 with domain-swapped transmembrane domain
9E4A 2.74 Å, Human ASIC1a at pH 8.5 with domain-swapped transmembrane domain
9E4K 2.77 Å, Human ASIC1a at pH 8.5, T26V mutation
9E4G 2.8 Å, Human ASIC1a at pH 5.7 with linear transmembrane domain
6L6N 2.86 Å, hASIC1a co-crystallized with Nafamostat
7RNN 2.86 Å, Human ASIC1a-Nb.C1 complex
9E4J 2.87 Å, Human ASIC1a at pH 6.5 in complex with MitTx
9E4B 3.09 Å, Human ASIC1a at pH 7.5 with domain-swapped transmembrane domain
9E4E 3.16 Å, Human ASIC1a at pH 6.5 with linear transmembrane domain
9E4D 3.19 Å, Human ASIC1a at pH 7.5 with linear transmembrane domain

Browse structure collections

About this viewer

MolViewer shows 7CFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.