7CH7: E.coli MlaFEB

Cryo-EM structure of E.coli MlaFEB. Determined by electron microscopy at 3.9 Å resolution. Released 19 May 2021.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Escherichia coli (strain K12)
Chains: 6
Atoms: 9,198
Mol. weight: 135.41 kDa
Released: 19 May 2021

Explore 7CH7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CH7 contains 63 α-helices and 34 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	14-18	5
α-helix	19-28	10
α-helix	40-47	8
α-helix	48-54	7
α-helix	56-78	23
α-helix	87-94	8
α-helix	95-99	5
α-helix	100-111	12
α-helix	117-126	10
α-helix	128-134	7
α-helix	139	1
α-helix	140-144	5
α-helix	145-171	27
α-helix	172-177	6
α-helix	190-192	3
α-helix	196-223	28
α-helix	231-258	28

Chain B: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	14-18	5
α-helix	19-28	10
α-helix	40-47	8
α-helix	48-54	7
α-helix	56-78	23
α-helix	87-97	11
α-helix	100-111	12
α-helix	117-126	10
α-helix	128-134	7
α-helix	139	1
α-helix	140-144	5
α-helix	145-171	27
α-helix	172-177	6
α-helix	190-192	3
α-helix	196-223	28
α-helix	231-258	28

Chains C and D: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
β-strand	15	1	2
β-strand	27-32	6	1
β-strand	37-40	4	3
α-helix	47-54	8
β-strand	62	1	2
β-strand	65-67	3	1
β-strand	71	1	1
α-helix	79-84	6
β-strand	90-91	2	3
α-helix	102-113	12
α-helix	118-132	15
α-helix	135-137	3
α-helix	147-159	13
β-strand	167-169	3	3
α-helix	177-191	15
β-strand	199-202	4	3
α-helix	205-208	4
β-strand	215-219	5	3
β-strand	222-227	6	3
α-helix	229-233	5
α-helix	238-245	8
α-helix	256-257	2

Chains E and F: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	7
β-strand	13-18	6	7
α-helix	26-29	4
α-helix	32-35	4
β-strand	41-43	3	7
β-strand	47	1	7
α-helix	52-65	14
β-strand	74-75	2	7
α-helix	79-87	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipid asymmetry maintenance ABC transporter permease subunit MlaE	A, B	protein	260	Escherichia coli (strain K12)	P64606 (AlphaFold model)
Phospholipid ABC transporter ATP-binding protein MlaF	C, D	protein	269	Escherichia coli (strain K12)	P63386 (AlphaFold model)
Lipid asymmetry maintenance protein MlaB	E, F	protein	97	Escherichia coli (strain K12)	P64602 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7CH7_1 Lipid asymmetry maintenance ABC transporter permease subunit MlaE (chains A, B)
MLLNALASLGHKGIKTLRTFGRAGLMLFNALVGKPEFRKHAPLLVRQLYNVGVLSMLIIV
VSGVFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVVAALLFAGRAGSALTAEI
GLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGIWGGSLVGVSWKGI
DSGFFWSAMQNAVDWRMDLVNCLIKSVVFAITVTWISLFNGYDAIPTSAGISRATTRTVV
HSSLAVLGLDFVLTALMFGN

Sequence of entity 2 (C, D), FASTA

>7CH7_2 Phospholipid ABC transporter ATP-binding protein MlaF (chains C, D)
MEQSVANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAP
DHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPL
LHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITM
GVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKKIVAHGSAQALQANPDPRV
RQFLDGIADGPVPFRYPAGDYHADLLPGS

Sequence of entity 3 (E, F), FASTA

>7CH7_3 Lipid asymmetry maintenance protein MlaB (chains E, F)
MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLH
LIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR

Primary citation

Structural Insight into Phospholipid Transport by the MlaFEBD Complex from P. aeruginosa. Zhou, C., Shi, H., Zhang, M. et al. J Mol Biol (2021) 433:166986-166986. DOI 10.1016/j.jmb.2021.166986 · PubMed

Other PDB entries of the same protein (UniProt P64606 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CGE 2.9 Å, The overall structure of nucleotide free MlaFEDB complex
6XBD 3.05 Å, Cryo-EM structure of MlaFEDB in nanodiscs with phospholipid substrates
6ZY3 3.3 Å, Cryo-EM structure of MlaFEDB in complex with phospholipid
6ZY9 3.3 Å, Cryo-EM structure of MlaFEDB in complex with AMP-PNP
7CH6 3.4 Å, Cryo-EM structure of E.coli MlaFEB with AMPPNP
6ZY2 3.6 Å, Cryo-EM structure of apo MlaFEDB
7CH0 3.7 Å, The overall structure of the MlaFEDB complex in ATP-bound EQclose conformation (Mutation…
6ZY4 4.1 Å, Cryo-EM structure of MlaFEDB in complex with ADP
7CGN 4.3 Å, The overall structure of the MlaFEDB complex in ATP-bound EQtall conformation (Mutation…

Browse structure collections

About this viewer

MolViewer shows 7CH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.