7CMH: The LAT2-4F2hc complex

The LAT2-4F2hc complex in complex with tryptophan. Determined by electron microscopy at 3.4 Å resolution. Released 23 Dec 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,368
Mol. weight: 134.03 kDa
Ligands: 3PH, TRP
Released: 23 Dec 2020

Explore 7CMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CMH contains 47 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	168-174	7
α-helix	179-199	21
α-helix	203-207	5
α-helix	212-215	4
β-strand	225-227	3	1
β-strand	228	1	2
α-helix	232-235	4
α-helix	242-245	4
α-helix	246-248	3
α-helix	249-255	7
β-strand	259-262	4	2
α-helix	263-264	2
α-helix	273-275	3
α-helix	289-300	12
β-strand	304-308	5	2
α-helix	326-341	16
β-strand	346-349	4	2
α-helix	357-371	15
β-strand	377-380	4	2
α-helix	386-392	7
β-strand	400-402	3	2
α-helix	413-427	15
β-strand	432-434	3	3
α-helix	451-458	8
β-strand	463-465	3	3
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	510-515	6
α-helix	521-533	13
α-helix	535-538	4
β-strand	541-544	4	4
β-strand	552-557	6	4
β-strand	563-568	6	4
β-strand	576	1	5
α-helix	581-583	3
α-helix	586-588	3
β-strand	593-599	7	4
β-strand	609-611	3	4
β-strand	616	1	5
β-strand	623-627	5	4

Chain B: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	42-53	12
α-helix	61-69	9
α-helix	72-99	28
α-helix	106-110	5
α-helix	117-125	9
α-helix	126-130	5
α-helix	131-146	16
α-helix	165-177	13
α-helix	181-185	5
α-helix	187-209	23
α-helix	231-233	3
α-helix	236-239	4
α-helix	255-257	3
α-helix	264-288	25
α-helix	293-296	4
α-helix	302-308	7
α-helix	314-335	22
α-helix	339-345	7
β-strand	357	1	6
α-helix	365-368	4
α-helix	370-379	10
α-helix	385-411	27
α-helix	427-444	18
α-helix	446-456	11
α-helix	459-464	6
α-helix	474-490	17
β-strand	494	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	647	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 2	B	protein	555	Homo sapiens	Q9UHI5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CMH_1 4F2 cell-surface antigen heavy chain (chains A)
MAHHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQ
AGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQD
TEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLS
KEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALY
RIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFG
SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF
QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL
SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV
FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRR
LSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPA
SASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAALE

Sequence of entity 2 (B), FASTA

>7CMH_2 Large neutral amino acids transporter small subunit 2 (chains B)
MADYKDDDDKSGPDEVDASGREEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEI
GLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTI
PKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESG
LRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPK
NAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVY
VFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRL
FFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYG
VTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGV
PVYFLGVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQ
PTPTKDKDVAGQPQP

Ligands and cofactors

ID	Name	Formula	Copies
3PH	1,2-diacyl-glycerol-3-sn-phosphate	C39 H77 O8 P	2
TRP	Tryptophan	C11 H12 N2 O2	1

Primary citation

Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex. Yan, R., Zhou, J., Li, Y. et al. Cell Discov (2020) 6:82-82. DOI 10.1038/s41421-020-00207-4 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 7CMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.