7CMI: The LAT2-4F2hc complex

The LAT2-4F2hc complex in complex with leucine. Determined by electron microscopy at 2.9 Å resolution. Released 23 Dec 2020.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,353
Mol. weight: 133.96 kDa
Ligands: LEU, 3PH
Released: 23 Dec 2020

Explore 7CMI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CMI contains 41 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	168-174	7
α-helix	179-182	4
α-helix	184-207	24
α-helix	211-215	5
β-strand	225-228	4	1
α-helix	231-235	5
α-helix	237-239	3
α-helix	244-248	5
α-helix	249-254	6
β-strand	259-262	4	1
α-helix	288-300	13
β-strand	304-308	5	1
α-helix	326-341	16
β-strand	345-348	4	1
α-helix	357-371	15
β-strand	376-380	5	1
α-helix	386-390	5
β-strand	400-402	3	1
α-helix	413-426	14
β-strand	432-434	3	2
α-helix	453-458	6
β-strand	463-465	3	2
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	510-513	4
α-helix	520-531	12
α-helix	535-538	4
β-strand	541-545	5	3
β-strand	552-557	6	3
β-strand	563-568	6	3
β-strand	576	1	4
β-strand	593-599	7	3
β-strand	609-611	3	3
β-strand	616	1	4
β-strand	622-627	6	3

Chain B: 23 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	42-53	12
α-helix	62-69	8
α-helix	72-99	28
α-helix	106-112	7
α-helix	117-125	9
α-helix	126-130	5
α-helix	131-146	16
α-helix	155-157	3
α-helix	158-177	20
α-helix	180-185	6
α-helix	189-209	21
α-helix	234-241	8
α-helix	255-257	3
α-helix	266-288	23
α-helix	293-296	4
α-helix	302-308	7
α-helix	314-335	22
α-helix	339-345	7
β-strand	357-358	2	5
α-helix	365-377	13
α-helix	386-411	26
α-helix	426-444	19
α-helix	446-466	21
α-helix	474-490	17
β-strand	493-494	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	647	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 2	B	protein	555	Homo sapiens	Q9UHI5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7CMI_1 4F2 cell-surface antigen heavy chain (chains A)
MAHHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQ
AGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQD
TEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLS
KEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALY
RIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFG
SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF
QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL
SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV
FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRR
LSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPA
SASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAALE

Sequence of entity 2 (B), FASTA

>7CMI_2 Large neutral amino acids transporter small subunit 2 (chains B)
MADYKDDDDKSGPDEVDASGREEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEI
GLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTI
PKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESG
LRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPK
NAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVY
VFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRL
FFAGAREGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYG
VTVAGQIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGV
PVYFLGVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQ
PTPTKDKDVAGQPQP

Ligands and cofactors

ID	Name	Formula	Copies
LEU	Leucine	C6 H13 N O2	1
3PH	1,2-diacyl-glycerol-3-sn-phosphate	C39 H77 O8 P	2

Primary citation

Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex. Yan, R., Zhou, J., Li, Y. et al. Cell Discov (2020) 6:82-82. DOI 10.1038/s41421-020-00207-4 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs

Browse structure collections

About this viewer

MolViewer shows 7CMI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.