7CNU: DLC2

Crystal structure of DLC2 in complex with BMF peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Aug 2021.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,225
Mol. weight: 35.79 kDa
Released: 11 Aug 2021

Explore 7CNU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CNU contains 6 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	1
β-strand	63-68	6	2
β-strand	73-78	6	1
β-strand	81-87	7	1

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	3
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	3
β-strand	68-78	11	3
β-strand	81-88	8	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-9	6	2

Chain E: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	4
α-helix	15-31	17
α-helix	35-50	16
β-strand	55-59	5	4
β-strand	68-78	11	4
β-strand	81-88	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 2, cytoplasmic	A, B, E	protein	96	Homo sapiens	Q96FJ2 (AlphaFold model)
Bcl-2-modifying factor	C	protein	20	Homo sapiens	Q96LC9 (AlphaFold model)

Sequence of entity 1 (A, B, E), FASTA

>7CNU_1 Dynein light chain 2, cytoplasmic (chains A, B, E)
MGHHHHHHSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (C), FASTA

>7CNU_2 Bcl-2-modifying factor (chains C)
TSQEDKATQTLSPASPSQGV

Primary citation

Non-canonical phosphorylation of Bmf by p38 MAPK promotes its apoptotic activity in anoikis. Zhi, Z., Ouyang, Z., Ren, Y. et al. Cell Death Differ (2022) 29:323-336. DOI 10.1038/s41418-021-00855-3 · PubMed

Other PDB entries of the same protein (UniProt Q96FJ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XQQ 1.31 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide…
4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
3P8M 2.9 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized…

Browse structure collections

About this viewer

MolViewer shows 7CNU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.