7CQ2: Slx1-Slx4

Crystal structure of Slx1-Slx4. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Jun 2021.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Saccharomyces cerevisiae (strain YJM789), Saccharomyces cerevisiae
Chains: 4
Atoms: 6,086
Mol. weight: 106.28 kDa
Ligands: ZN
Released: 16 Jun 2021

Explore 7CQ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CQ2 contains 32 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	15-21	7	1
β-strand	28-33	6	1
α-helix	36-43	8
α-helix	61	1
β-strand	63-70	8	1
α-helix	75-87	13
α-helix	89-93	5
α-helix	110-122	13
α-helix	124-127	4
β-strand	132-137	6	1
α-helix	138-146	9
β-strand	160-167	8	1
α-helix	175-212	38
β-strand	217	1	2
β-strand	224	1	2
α-helix	232-234	3
β-strand	238-240	3	3
β-strand	249-251	3	3
α-helix	252-267	16
β-strand	276-278	3	4
β-strand	285-287	3	4
α-helix	288-301	14

Chain B: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	15-21	7	5
β-strand	28-33	6	5
α-helix	36-43	8
β-strand	49	1	6
β-strand	52	1	6
α-helix	61	1
β-strand	63-70	8	5
α-helix	75-86	12
α-helix	110-122	13
α-helix	124-127	4
β-strand	132-137	6	5
α-helix	138-146	9
β-strand	159-167	9	5
α-helix	168-170	3
α-helix	175-211	37
β-strand	216-217	2	7
β-strand	224-225	2	7
β-strand	238-240	3	8
β-strand	249-251	3	8
α-helix	252-263	12
β-strand	276-278	3	9
β-strand	285-287	3	9
α-helix	288-301	14

Chain C: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	681-692	12
α-helix	696-703	8
β-strand	708-709	2	10
α-helix	710-720	11
α-helix	722-726	5
α-helix	729-739	11
α-helix	741-742	2
β-strand	743-744	2	10

Chain D: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	681-692	12
α-helix	696-702	7
β-strand	708-709	2	11
α-helix	710-720	11
α-helix	722-726	5
α-helix	729-739	11
β-strand	743-744	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structure-specific endonuclease subunit SLX1	A, B	protein	304	Saccharomyces cerevisiae (strain YJM789)	P38324 (AlphaFold model)
SLX4 isoform 1	C, D	protein	150	Saccharomyces cerevisiae	Q12098 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7CQ2_1 Structure-specific endonuclease subunit SLX1 (chains A, B)
MSQKIQQHQFPDFYCCYLLQSINKRQSFYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGS
RPWEMIMIVRGFPSKIAALQFEHAWQHGYQTHYIAEKDRVVKHKAGGRTLHHKVALMKLL
LKHEFFQRMNLIVEVFNIKAWEVWKQDKFFIERDRFPINIQINENALEEPKEKTVDVLMD
HSDENLKVVEAVYTKVIENERNIFETFEKKLTTGVVRCEICEKEIDYTSEEQNLKPFVAL
CNNKDCGCVNHLKCLHRYFLDDEQLIVGRRNLIPRGGKCPKCDMFCDWTTLVKFSTRMKL
AHGK

Sequence of entity 2 (C, D), FASTA

>7CQ2_2 SLX4 isoform 1 (chains C, D)
MGSSHHHHHHSQSAASSIASPEKFCEIMMSQSMKELRQSLKTVGLKPMRTKVEIIQSLQT
ASQILSTANPDNKGEHGGVANFSKIEIFDHLTELIEAFPDFLERIYTFEPIPLNELIEKL
FSAEPFVSQIDEMTIREWADVQGICLRNDK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure specific DNA recognition by the SLX1-SLX4 endonuclease complex. Xu, X., Wang, M., Sun, J. et al. Nucleic Acids Res (2021) 49:7740-7752. DOI 10.1093/nar/gkab542 · PubMed

Other PDB entries of the same protein (UniProt P38324 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CQ3 1.45 Å, Crystal structure of Slx1-Slx4
7CQ4 3.29 Å, Crystal structure of Slx1-Slx4 in complex with 5'flap DNA

Browse structure collections

About this viewer

MolViewer shows 7CQ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.