7CSP: Ephexin4 IDPSH

Structure of Ephexin4 IDPSH. Determined by X-ray diffraction at 3.0 Å resolution. Released 24 Feb 2021.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,349
Mol. weight: 114.91 kDa
Released: 24 Feb 2021

Explore 7CSP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CSP contains 47 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	220-222	3
α-helix	226-228	3
α-helix	273-276	4
α-helix	284-310	27
α-helix	311-315	5
α-helix	318-321	4
α-helix	326-333	8
α-helix	336-356	21
α-helix	364-373	10
α-helix	376-383	8
α-helix	385-398	14
α-helix	400-411	12
α-helix	420-424	5
α-helix	426-443	18
α-helix	449-488	40
β-strand	489-490	2	1
β-strand	506-514	9	1
α-helix	519-521	3
β-strand	529-535	7	1
β-strand	538-546	9	1
β-strand	549-557	9	1
α-helix	558-560	3
β-strand	561-565	5	1
α-helix	566-570	5
β-strand	586-591	6	1
β-strand	600-605	6	1
α-helix	609-619	11
α-helix	625-630	6
α-helix	632-634	3
α-helix	636	1
β-strand	637-640	4	2
β-strand	644	1	3
β-strand	651	1	2
β-strand	654	1	3
β-strand	659-666	8	2
β-strand	669-674	6	2
β-strand	680-684	5	2
α-helix	685-687	3
β-strand	688-691	4	2
α-helix	694-707	14

Chain B: 23 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	220-222	3
α-helix	267-269	3
α-helix	271-276	6
α-helix	284-310	27
α-helix	311-315	5
α-helix	318-321	4
α-helix	326-333	8
α-helix	336-356	21
α-helix	364-373	10
α-helix	376-398	23
α-helix	400-411	12
α-helix	421-424	4
α-helix	426-443	18
α-helix	449-488	40
β-strand	489-490	2	4
α-helix	491-493	3
β-strand	506-514	9	4
β-strand	529-535	7	4
β-strand	538-544	7	4
β-strand	550-557	8	4
α-helix	558-560	3
β-strand	561-565	5	4
α-helix	566-570	5
β-strand	586-591	6	4
β-strand	594	1	4
β-strand	600-605	6	4
α-helix	609-619	11
α-helix	621-627	7
α-helix	628-634	7
α-helix	636	1
β-strand	637-640	4	5
β-strand	644	1	6
β-strand	651	1	5
β-strand	654	1	6
β-strand	659-666	8	5
β-strand	669-674	6	5
β-strand	680-684	5	5
α-helix	685-687	3
β-strand	688-690	3	5
α-helix	694-707	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 16	A, B	protein	500	Mus musculus	Q3U5C8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7CSP_1 Rho guanine nucleotide exchange factor 16 (chains A, B)
GPGSEFHKGSFKDDPQLYQEIRERGLNTSHESDDDILDETTIVVKSYRPAQLTWSQLPEV
LESGVLDTLSTEERKRQEAIFEILTSEFSYLHSLSILVTEFLQSRELRATMTQTEHHHLF
SNILDVMSASQKFFEALEQRHKAQVCVEDISDILEDHAQHHFHPYIAYCSNEVYQQRTLQ
KLSNSNAAFRDVLKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKTQGHPERYK
AASQALKAISKLVKQCNEGAHKMERTEQIYTLNMQLDFGKVKSLPLISASRWLLKRGELF
LLEESSIFRKIASRPTCYLFLFNDVLVVTKKKSEESYLVQDYAQLDHVQVRKLEPSEPLL
PGGSSRSSSVPYPFQVNLLHNSEGRQEQILLSSDSASDRARWITALTYKERQWQGITNKG
ELPQVEVTKAYFAKQADEITLQQADIVLVLQEEDGWLHGERLRDGETGWFPESFAHSITS
RVAVEGNVRRMERLRVETDV

Primary citation

Double inhibition and activation mechanisms of Ephexin family RhoGEFs. Zhang, M., Lin, L., Wang, C. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2024465118 · PubMed

Other PDB entries of the same protein (UniProt Q3U5C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YKF 2.28 Å, Crystal structure of MAGI2 PDZ0-GK/pEphexin4 complex
7CSO 2.39 Å, Structure of Ephexin4 DH-PH-SH3
7CSR 3.0 Å, Structure of Ephexin4 R676L

Browse structure collections

About this viewer

MolViewer shows 7CSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.